Property Summary

NCBI Gene PubMed Count 108
PubMed Score 100.17
PubTator Score 87.08

Knowledge Summary

Patent (12,192)

Expression

  Differential Expression (20)

Disease log2 FC p
pancreatic cancer -1.300 2.4e-02
astrocytoma 1.300 1.1e-23
glioblastoma 1.700 5.3e-06
oligodendroglioma 1.100 1.4e-08
osteosarcoma 1.606 5.0e-03
posterior fossa group A ependymoma 1.600 1.1e-12
medulloblastoma 1.400 1.2e-03
atypical teratoid / rhabdoid tumor 1.300 7.4e-07
medulloblastoma, large-cell 1.100 4.1e-02
primitive neuroectodermal tumor 1.200 1.3e-03
juvenile dermatomyositis 1.096 5.2e-11
Breast cancer 3.800 2.2e-02
pediatric high grade glioma 1.500 3.7e-06
pilocytic astrocytoma 1.300 1.4e-07
pancreatic carcinoma -1.300 2.4e-02
invasive ductal carcinoma -1.233 2.3e-03
progressive supranuclear palsy -1.300 3.6e-02
ovarian cancer 1.600 6.1e-03
Down syndrome 1.500 6.1e-04
dermatomyositis 1.100 2.6e-03

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
686946 summary 0 / 0 / 0 qHTS for small molecule inhibitors of Yes1 kinase: Summary
686947 confirmatory 361 / 116 / 381 qHTS for small molecule inhibitors of Yes1 kinase: Primary Screen
686948 confirmatory 17 / 0 / 0 qHTS for small molecule inhibitors of Yes1 kinase: Confirmatory screen on the cherrypicks

Gene RIF (38)

PMID Text
26676187 Up-regulation of miR-210 inhibits hepatocellular carcinoma cell proliferation. Yes1 is a target of miR-210 and affects cell proliferation in HCC.
25925378 Increased YES/SFK activation might serve as a clinical biomarker for predicting tumor resistance to IGF-1R inhibition.
25910964 findings indicate that miR-203 induces the apoptosis of KB cells by directly targeting Yes-1, suggesting its application in anti-cancer therapeutics
25868388 Results demonstrate a unique role for Yes in phosphorylation of FAK and in promoting PCa metastasis. Therefore, phosphorylated FAK Y861 and increased Yes expression may be predictive markers for PCa metastasis.
25561420 results indicated that miR-17-5p might play a role in human ovarian cancer by up-regulating YES1 expression.
24610809 YES kinase as a proximal glucose-specific signal in the Cdc42-signaling cascade.
24323901 YES1 and YAP transcript levels were higher in liver metastases of patients with colon cancer after 5FU-based neoadjuvant chemotherapy.
23898208 HIV-1 Tat downregulates the expression of v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1) in human primary T cells
23497302 Expression of HPV type 16 E7 resulted in increase in Src and Yes proteins level, but did not alter the level of Fyn.
23318429 we identified CRKL/YES as critical interrelated pathways necessary for rhabdomyosarcoma cell growth and survival and suggest a potential therapeutic role of SRC family kinase inhibition in the treatment of rhabdomyosarcoma.
22948717 study concludes that Yes is a central mediator for malignant mesothelioma cell growth that is not shared with other Src family kinases such as c-Src
22430206 Taken together, our findings demonstrate that Yes and Lyn phosphorylate EGFR at Y1101, which influences EGFR nuclear translocation in this model of cetuximab resistance.
21454696 Functional activation of Src family kinase yes protein is essential for the enhanced malignant properties of human melanoma cells expressing ganglioside GD3.
21390316 c-Yes regulates specific oncogenic signalling pathways important for colon cancer progression that is not shared with c-Src.
21190720 Yes-associated protein may play important roles in different pathways in distinct lung tumor subtypes.
20796316 c-Yes was expressed in malignant melanoma, and squamous cell carcinoma type skin neoplasms.
20098684 Both YES and STAT1 were verified as direct miR-145 targets
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19893451 Study identified the previously reported pathogenic mutation of NTRK3 in a KRAS/BRAF wild-type tumor and 2 somatic mutations in the Src family of kinases (YES1 and LYN) that would be expected to cause structural changes.
19797678 Data show that found that IFIH1, a susceptibility gene of type 1 diabetes, interacts with YES1, which plays a role in glucose transport.
19757166 Cloning of the complete coding sequence of the cDNA of the Csk and Yes tyrosine kinases genes of the human lymphocytes and retina have been carried out.
19258394 These results suggest that SFK trafficking is specified by the palmitoylation state in the SH4 domain.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18328427 Binding of CD95 Ligand to CD95 on glioblastoma cells recruit Yes and the p85 subunit of phosphatidylinositol 3-kinase to CD95, which signal invasion via the glycogen synthase kinase 3-beta pathway and subsequent expression of matrix metalloproteinases.
17898870 c-Yes induction results in increased colorectal carcinoma cell motility but did not promote proliferation. In later stages of colorectal carcinogenesis, elevations in c-Yes levels/activity may promote cancer spread & metastasis rather than tumor growth.
17692281 Thus, these results suggest that endogenous c-Src, c-Yes, and Lyn are differentially activated through Cdc2 activation during M phase.
17418139 Amyloid aggregation by an SH3 domain from the Src family.
17143518 Nucleus-located c-Yes may be a useful marker to detect early-stage hepatocellular carcinoma.
17109515 The results were confirmed at the level of mRNA and protein, and suggested that four genes (OPCML, RNASE1, YES1 and ACK1) could play a key role in the tumorigenesis and metastasis of gastric cancer.
17007035 activation of the protooncogene product c-Yes may play a significant role in the malignant transformation of hepatocytes
16880514 NFAT1, a transcription factor connected with breast cancer metastasis, is activated by Wnt-5a through a Ca2+ signaling pathway in human breast epithelial cells which was simultaneously counteracted by a Wnt-5a-induced Yes/Cdc42 signaling pathway.
16400523 Vascular endothelial growth factor (VEGF)-induced cell migration is significantly decreased in Yes-deficient retinal microvascular endothelial cells.
16289864 c-Yes 3'-UTR contains at least three newly identified adenine/uridine-rich elements (AREs) which are bound specifically by ARE-binding proteins HuR and AUF1.
15148312 activation of c-Yes is important for maintaining embryonic stem cells in an undifferentiated state
15039424 Src family kinase Yes triggers hyperosmotic activation of the epidermal growth factor receptor and CD95
12456296 This review summarizes the potential functions of c-Yes and its ability to modulate signals that are distinct from c-Src.
12138090 QM binds to c-yes at the SH3 domain in tumor cell lines
12080032 cAMP activates while Ca(2+) inhibits human sperm c-yes kinase activity

AA Sequence

MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTP      1 - 70
FGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKNG     71 - 140
YIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVK    141 - 210
HYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLE    211 - 280
VKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEF    281 - 350
MSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARL    351 - 420
IEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYR    421 - 490
MPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL                     491 - 543
//

Text Mined References (121)

PMID Year Title
26676187 2015 Up-regulation of microRNA-210 inhibits proliferation of hepatocellular carcinoma cells by targeting YES1.
25925378 2015 IGF-1R Inhibition Activates a YES/SFK Bypass Resistance Pathway: Rational Basis for Co-Targeting IGF-1R and Yes/SFK Kinase in Rhabdomyosarcoma.
25910964 2015 miR-203 downregulates Yes-1 and suppresses oncogenic activity in human oral cancer cells.
25868388 2015 Yes-mediated phosphorylation of focal adhesion kinase at tyrosine 861 increases metastatic potential of prostate cancer cells.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25561420 2015 MiR-17-5p up-regulates YES1 to modulate the cell cycle progression and apoptosis in ovarian cancer cell lines.
25416956 2014 A proteome-scale map of the human interactome network.
24860872 2014 Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24610809 2014 YES, a Src family kinase, is a proximal glucose-specific activator of cell division cycle control protein 42 (Cdc42) in pancreatic islet ? cells.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24323901 2014 Colon cancer cells escape 5FU chemotherapy-induced cell death by entering stemness and quiescence associated with the c-Yes/YAP axis.
23866081 2013 Lyn, a Src family kinase, regulates activation of epidermal growth factor receptors in lung adenocarcinoma cells.
23541324 2013 Genome-wide association study identifies TH1 pathway genes associated with lung function in asthmatic patients.
23497302 2013 Activation of Src, Fyn and Yes non-receptor tyrosine kinases in keratinocytes expressing human papillomavirus (HPV) type 16 E7 oncoprotein.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23318429 2013 Loss-of-function screen in rhabdomyosarcoma identifies CRKL-YES as a critical signal for tumor growth.
22948717 2012 Yes is a central mediator of cell growth in malignant mesothelioma cells.
22430206 2013 Yes and Lyn play a role in nuclear translocation of the epidermal growth factor receptor.
21713032 2011 The naturally processed CD95L elicits a c-yes/calcium/PI3K-driven cell migration pathway.
21566460 2011 Clues for c-Yes involvement in the cell cycle and cytokinesis.
21454696 2011 Functional activation of Src family kinase yes protein is essential for the enhanced malignant properties of human melanoma cells expressing ganglioside GD3.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21390316 2011 Specific oncogenic activity of the Src-family tyrosine kinase c-Yes in colon carcinoma cells.
21190720 2011 Differential expression of Yes-associated protein is correlated with expression of cell cycle markers and pathologic TNM staging in non-small-cell lung carcinoma.
20796316 2010 Elevated c-Src and c-Yes expression in malignant skin cancers.
20605918 2010 The Lyn kinase C-lobe mediates Golgi export of Lyn through conformation-dependent ACSL3 association.
20098684 2010 MicroRNA-145 targets YES and STAT1 in colon cancer cells.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19893451 2009 Resequencing analysis of the human tyrosine kinase gene family in pancreatic cancer.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19797678 2009 Coexpression network based on natural variation in human gene expression reveals gene interactions and functions.
19757166 2010 Role of the Yes and Csk tyrosine kinases in the development of a pathological state in the human retina.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19276087 2009 Phosphorylation of collapsin response mediator protein 2 on Tyr-479 regulates CXCL12-induced T lymphocyte migration.
19267251 2009 Cooperation between integrin alphavbeta3 and VEGFR2 in angiogenesis.
19258394 2009 Differential trafficking of Src, Lyn, Yes and Fyn is specified by the state of palmitoylation in the SH4 domain.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18697750 2008 Gab2 is involved in differential phosphoinositide 3-kinase signaling by two splice forms of c-Kit.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18479465 2008 Phosphorylation of cyclin dependent kinase 4 on tyrosine 17 is mediated by Src family kinases.
18328427 2008 Yes and PI3K bind CD95 to signal invasion of glioblastoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17898870 2007 Increases in c-Yes expression level and activity promote motility but not proliferation of human colorectal carcinoma cells.
17692281 2007 Differential mitotic activation of endogenous c-Src, c-Yes, and Lyn in HeLa cells.
17418139 2007 Crystallographic structure of the SH3 domain of the human c-Yes tyrosine kinase: loop flexibility and amyloid aggregation.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17254967 2007 p27 phosphorylation by Src regulates inhibition of cyclin E-Cdk2.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17143518 2007 Identification of c-Yes expression in the nuclei of hepatocellular carcinoma cells: involvement in the early stages of hepatocarcinogenesis.
17109515 2006 Comparison of gene expression profiles between primary tumor and metastatic lesions in gastric cancer patients using laser microdissection and cDNA microarray.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17007035 2006 Activation of c-Yes in hepatocellular carcinoma: a preliminary study.
16964398 2006 EG-1 interacts with c-Src and activates its signaling pathway.
16921024 2006 Differential kinase requirements in human and mouse Fc-gamma receptor phagocytosis and endocytosis.
16880514 2006 Wnt-5a/Ca2+-induced NFAT activity is counteracted by Wnt-5a/Yes-Cdc42-casein kinase 1alpha signaling in human mammary epithelial cells.
16439366 2006 Docking-based substrate recognition by the catalytic domain of a protein tyrosine kinase, C-terminal Src kinase (Csk).
16400523 2005 Src, Fyn and Yes play differential roles in VEGF-mediated endothelial cell events.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16338789 2005 c-Yes response to growth factor activation.
16289864 2005 The c-Yes 3'-UTR contains adenine/uridine-rich elements that bind AUF1 and HuR involved in mRNA decay in breast cancer cells.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15657067 2005 Phosphotyrosine signaling networks in epidermal growth factor receptor overexpressing squamous carcinoma cells.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15148312 2004 The Src family of tyrosine kinases is important for embryonic stem cell self-renewal.
15039424 2004 The Src family kinase Yes triggers hyperosmotic activation of the epidermal growth factor receptor and CD95.
14980517 2004 Protein tyrosine phosphatase epsilon activates Yes and Fyn in Neu-induced mammary tumor cells.
12923167 2003 Tyrosyl phosphorylation of Shp2 is required for normal ERK activation in response to some, but not all, growth factors.
12846735 2003 Clustering-induced tyrosine phosphorylation of nephrin by Src family kinases.
12538589 2003 Regulation of a transient receptor potential (TRP) channel by tyrosine phosphorylation. SRC family kinase-dependent tyrosine phosphorylation of TRPV4 on TYR-253 mediates its response to hypotonic stress.
12509223 2002 Src kinase becomes preferentially associated with the VEGFR, KDR/Flk-1, following VEGF stimulation of vascular endothelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456296 2003 Specificity in signaling by c-Yes.
12138090 2002 QM, a putative tumor suppressor, regulates proto-oncogene c-yes.
12080032 2002 Regulation of the human sperm tyrosine kinase c-yes. Activation by cyclic adenosine 3',5'-monophosphate and inhibition by Ca(2+).
11950934 2002 Nonreceptor tyrosine kinase c-Yes interacts with occludin during tight junction formation in canine kidney epithelial cells.
11901164 2002 CD46 is phosphorylated at tyrosine 354 upon infection of epithelial cells by Neisseria gonorrhoeae.
11684709 2001 EGF-R signaling through Fyn kinase disrupts the function of integrin alpha6beta4 at hemidesmosomes: role in epithelial cell migration and carcinoma invasion.
11546805 2001 beta -Arrestin-mediated recruitment of the Src family kinase Yes mediates endothelin-1-stimulated glucose transport.
11448999 2001 Vav2 is required for cell spreading.
11312300 2001 Src, Fyn, and Yes are not required for neuromuscular synapse formation but are necessary for stabilization of agrin-induced clusters of acetylcholine receptors.
11278422 2001 Yes-associated protein and p53-binding protein-2 interact through their WW and SH3 domains.
11127814 2000 Meltrin alpha cytoplasmic domain interacts with SH3 domains of Src and Grb2 and is phosphorylated by v-Src.
11071635 2000 Stem cell factor induces phosphatidylinositol 3'-kinase-dependent Lyn/Tec/Dok-1 complex formation in hematopoietic cells.
11039464 2000 GP2, a GPI-anchored protein in the apical plasma membrane of the pancreatic acinar cell, co-immunoprecipitates with src kinases and caveolin.
10861086 2000 Differential involvement of Src family kinases in Fc gamma receptor-mediated phagocytosis.
10858437 2000 Collagen, convulxin, and thrombin stimulate aggregation-independent tyrosine phosphorylation of CD31 in platelets. Evidence for the involvement of Src family kinases.
10562288 1999 Yes-associated protein 65 localizes p62(c-Yes) to the apical compartment of airway epithelia by association with EBP50.
10339567 1999 CMS: an adapter molecule involved in cytoskeletal rearrangements.
9892651 1999 PSD-95 promotes Fyn-mediated tyrosine phosphorylation of the N-methyl-D-aspartate receptor subunit NR2A.
9799234 1998 Kit signaling through PI 3-kinase and Src kinase pathways: an essential role for Rac1 and JNK activation in mast cell proliferation.
9794236 1998 Autophosphorylation of Src and Yes blocks their inactivation by Csk phosphorylation.
9281320 1997 Expression, purification, and initial characterization of human Yes protein tyrosine kinase from a bacterial expression system.
8918464 1996 STK/RON receptor tyrosine kinase mediates both apoptotic and growth signals via the multifunctional docking site conserved among the HGF receptor family.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8702385 1996 Complex formation of JAK2 with PP2A, P13K, and Yes in response to the hematopoietic cytokine interleukin-11.
8449516 1993 Chromosomal reassignment: YACs containing both YES1 and thymidylate synthase map to the short arm of chromosome 18.
7980442 1994 Palmitoylation of multiple Src-family kinases at a homologous N-terminal motif.
7929439 1994 Different signal transduction properties of KDR and Flt1, two receptors for vascular endothelial growth factor.
7685273 1993 Identification of two juxtamembrane autophosphorylation sites in the PDGF beta-receptor; involvement in the interaction with Src family tyrosine kinases.
7681396 1993 Activation of Src family kinases by colony stimulating factor-1, and their association with its receptor.
7641887 1995 Characterization of a novel protein-binding module--the WW domain.
7537495 1995 Autophosphorylation activity and association with Src family kinase of Sky receptor tyrosine kinase.
7521304 1994 Src-related protein tyrosine kinases are physically associated with the surface antigen CD36 in human dermal microvascular endothelial cells.
3332005 1986 Nakahara memorial lecture. Non-receptor type protein-tyrosine kinases closely related to src and yes compose a multigene family.
2983418 1985 Location of the c-yes gene on the human chromosome and its expression in various tissues.
2436037 1987 Characterization of cDNA clones for the human c-yes gene.
2267131 1990 Expression of cellular-yes protein in mammalian tissues.
2067846 1991 Differential expression of p62c-yes in normal, hyperplastic and neoplastic human epidermis.
2021534 1991 Distribution of c-yes-1 gene product in various cells and tissues.
1720539 1991 Two additional protein-tyrosine kinases expressed in human lung: fourth member of the fibroblast growth factor receptor family and an intracellular protein-tyrosine kinase.
1715582 1991 Membrane glycoprotein IV (CD36) is physically associated with the Fyn, Lyn, and Yes protein-tyrosine kinases in human platelets.
1544885 1992 p21rasGAP association with Fyn, Lyn, and Yes in thrombin-activated platelets.
1384720 1992 The p60c-src family of protein-tyrosine kinases: structure, regulation, and function.
1381360 1992 Steel factor stimulates the tyrosine phosphorylation of the proto-oncogene product, p95vav, in human hemopoietic cells.