Property Summary

NCBI Gene PubMed Count 27
PubMed Score 27.31
PubTator Score 20.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
Rheumatoid Arthritis 1.100 3.9e-02
malignant mesothelioma 1.400 5.0e-06
group 4 medulloblastoma 2.000 3.2e-04
lung cancer 2.000 8.8e-05

Gene RIF (11)

PMID Text
26307679 YEATS4 overexpression is associated with drug resistance of ovarian cancer.
24170126 Findings reveal YEATS4 as a candidate oncogene amplified in NSCLC, and a novel mechanism contributing to NSCLC pathogenesis
22619067 GAS41 amplification results in overexpression and associtated with glioblastoma.
22350108 Our data confirm previous genome-wide findings at 12q15 and suggest differential YEATS4 expression could underpin rs7297610-associated HCTZ response variability, which may have future implications for guiding thiazide treatment.
22068108 Gas41 is able to bind both n-Myc and c-Myc proteins, and that the levels of expression of Gas41 and Myc proteins were similar to each other in such brain tumors as neuroblastomas and glioblastomas.
21317290 The GAS41-PP2Cbeta complex dephosphorylates p53 at serine 366 and regulates its stability
20618999 The in vivo interaction of GAS41 and endogenous RAP30 and RAP74 was confirmed by co-immunoprecipitation. GAS41 binds to two non-overlapping regions of the C-terminus of RAP30.
18591461 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18214854 Overexpression of YEATS4 is associated with well-differentiated and dedifferentiated liposarcomas
16705155 GAS41 plays a role in repressing the p53 tumor suppressor pathway during the normal cell cycle by a TIP60-independent mechanism.
11903063 Interaction of the transforming acidic coiled-coil 1 (TACC1) protein with ch-TOG and GAS41/NuBI1 suggests multiple TACC1-containing protein complexes in human cells

AA Sequence

MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKL      1 - 70
HESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYD     71 - 140
EMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINC    141 - 210
LKNEIRKLEEDDQAKDI                                                         211 - 227
//

Text Mined References (28)

PMID Year Title
26307679 2015 Transcriptome analysis indicates TFEB1 and YEATS4 as regulatory transcription factors for drug resistance of ovarian cancer.
24170126 2013 YEATS4 is a novel oncogene amplified in non-small cell lung cancer that regulates the p53 pathway.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
22619067 2012 GAS41 amplification results in overexpression of a new spindle pole protein.
22350108 2013 Association of chromosome 12 locus with antihypertensive response to hydrochlorothiazide may involve differential YEATS4 expression.
22068108 2011 Direct interaction of Gas41 and Myc encoded by amplified genes in nervous system tumours.
21317290 2011 The GAS41-PP2Cbeta complex dephosphorylates p53 at serine 366 and regulates its stability.
21269460 2011 Initial characterization of the human central proteome.
20618999 2010 The YEATS family member GAS41 interacts with the general transcription factor TFIIF.
18591461 2008 Genomic association analysis suggests chromosome 12 locus influencing antihypertensive response to thiazide diuretic.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18214854 2008 HMGA2 is the partner of MDM2 in well-differentiated and dedifferentiated liposarcomas whereas CDK4 belongs to a distinct inconsistent amplicon.
16705155 2006 GAS41 is required for repression of the p53 tumor suppressor pathway during normal cellular proliferation.
15647280 2005 The mammalian YL1 protein is a shared subunit of the TRRAP/TIP60 histone acetyltransferase and SRCAP complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15196461 2004 The highly conserved and multifunctional NuA4 HAT complex.
14966270 2004 Structural and functional conservation of the NuA4 histone acetyltransferase complex from yeast to humans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12963728 2003 Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex.
12620397 2003 Molecular cloning, genomic structure and interactions of the putative breast tumor suppressor TACC2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11903063 2002 Interaction of the transforming acidic coiled-coil 1 (TACC1) protein with ch-TOG and GAS41/NuBI1 suggests multiple TACC1-containing protein complexes in human cells.
11901157 2002 Targeted disruption of the GAS41 gene encoding a putative transcription factor indicates that GAS41 is essential for cell viability.
11756182 2002 The MLL fusion partner AF10 binds GAS41, a protein that interacts with the human SWI/SNF complex.
11521196 2001 Expression, cellular distribution and protein binding of the glioma amplified sequence (GAS41), a highly conserved putative transcription factor.
10913114 2000 GAS41, a highly conserved protein in eukaryotic nuclei, binds to NuMA.
9302258 1997 Cloning of a novel transcription factor-like gene amplified in human glioma including astrocytoma grade I.
8733125 1996 Isolation of genes amplified in human cancers by microdissection mediated cDNA capture.