Property Summary

NCBI Gene PubMed Count 28
PubMed Score 141.78
PubTator Score 66.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
chronic lymphocytic leukemia 1.736 1.0e-03
esophageal adenocarcinoma -1.300 1.9e-02
astrocytoma 2.000 2.3e-02
glioblastoma 2.700 1.8e-03
posterior fossa group A ependymoma 1.300 3.4e-07
pancreatic ductal adenocarcinoma liver m... 2.889 6.6e-04
intraductal papillary-mucinous neoplasm ... -2.500 4.3e-02
lung cancer -1.600 1.6e-04
pediatric high grade glioma 1.300 1.9e-04
group 4 medulloblastoma -2.100 3.3e-05
subependymal giant cell astrocytoma 2.107 1.7e-02
invasive ductal carcinoma -1.600 1.4e-03
lung carcinoma -2.400 6.1e-31
spina bifida -2.138 3.7e-02
Pick disease 1.400 3.4e-02
Breast cancer -1.600 1.4e-05
ovarian cancer 1.900 3.5e-05
pituitary cancer -4.100 3.3e-12

Gene RIF (12)

PMID Text
24885929 Stratification according to Fuhrman grade disclosed higher YBX3 expression levels.
24817634 In the prenatal brain, the cold shock domain protein A were found to be abundantly expressed in radial glial cells, neuroblasts and neurons.
22711822 We demonstrate that ZONAB promotes cell survival in response to proinflammatory, hyperosmotic, and cytotoxic stress and that stress-induced ZONAB activation involves the Rho regulator GEF-H1.
22159460 DbpA promoter was methylated in 37.7% of HCC samples.
21473684 In human skeletal muscle cells, CSDA was upregulated during hypoxia when cells were damaged and apoptosis was induced.
20133480 ZONAB is an important component of the mechanisms that sense epithelial density and participates in the complex transcriptional networks that regulate the switch between proliferation and differentiation
19749785 The expression of human DBPA was upregulated in gastric cancer tissues and cell lines. siRNA treatment successfully silenced DBPA expression.
19328795 The symplekin/ZONAB complex inhibits intestinal cell differentiation by the repression of AML1/Runx1.
19240061 Observational study of gene-disease association. (HuGE Navigator)
16508013 ZONAB regulates the transcription of genes that are important for G1/S-phase progression and links tight junctions to the transcriptional control of key cell cycle regulators and epithelial cell differentiation.
14728692 identification of complexes, binding to the vascular endothelial growth factor mRNA 5'- and 3'-UTR, that contain cold shock domain and polypyrimidine tract binding RNA binding proteins
12239625 human dbpA has a role in accelerating hepatocarcinogenesis

AA Sequence

MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAA      1 - 70
ASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGET     71 - 140
VEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPP    141 - 210
ATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGP    211 - 280
VHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGK    281 - 350
EAKAGEAPTENPAPPTQQSSAE                                                    351 - 372
//

Text Mined References (38)

PMID Year Title
24885929 2014 Validation of housekeeping gene and impact on normalized gene expression in clear cell renal cell carcinoma: critical reassessment of YBX3/ZONAB/CSDA expression.
24817634 2015 Differential distribution of Y-box-binding protein 1 and cold shock domain protein A in developing and adult human brain.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22711822 2012 Stress- and Rho-activated ZO-1-associated nucleic acid binding protein binding to p21 mRNA mediates stabilization, translation, and cell survival.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22159460 2012 DNA binding protein A expression and methylation status in hepatocellular carcinoma and the adjacent tissue.
21473684 2011 Critical roles of cold shock domain protein A as an endogenous angiogenesis inhibitor in skeletal muscle.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20133480 2010 ZONAB promotes proliferation and represses differentiation of proximal tubule epithelial cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19749785 2009 Upregulation of human DNA binding protein A (dbpA) in gastric cancer cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19328795 2009 The symplekin/ZONAB complex inhibits intestinal cell differentiation by the repression of AML1/Runx1.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16508013 2006 Regulation of PCNA and cyclin D1 expression and epithelial morphogenesis by the ZO-1-regulated transcription factor ZONAB/DbpA.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15592429 2005 RalA interacts with ZONAB in a cell density-dependent manner and regulates its transcriptional activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15313206 2004 Transcription of dbpA, a Y box binding protein, is positively regulated by E2F1: implications in hepatocarcinogenesis.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14728692 2004 A multi-protein complex containing cold shock domain (Y-box) and polypyrimidine tract binding proteins forms on the vascular endothelial growth factor mRNA. Potential role in mRNA stabilization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12239625 2002 Somatic mutation and SNP in the promoter of dbpA and human hepatocarcinogenesis.
10343102 1999 Assignment of a human cold shock domain protein A intronless pseudogene (CSDAP1) to human chromosome 16 band p11.2 by in situ hybridization.
9442396 1997 Repression mechanisms of the I-A beta gene of the major histocompatibility complex.
8710501 1996 Cold shock domain proteins repress transcription from the GM-CSF promoter.
7628487 1995 Characterization of the gene for dbpA, a family member of the nucleic-acid-binding proteins containing a cold-shock domain.
2977358 1988 Two human genes isolated by a novel method encode DNA-binding proteins containing a common region of homology.