Property Summary

NCBI Gene PubMed Count 40
PubMed Score 264.55
PubTator Score 49.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.100 4.9e-02
primary pancreatic ductal adenocarcinoma -1.054 4.1e-03
colon cancer 1.100 2.8e-04
diabetes mellitus -1.300 3.8e-03
ovarian cancer 2.000 8.6e-06
pancreatic cancer -1.400 5.1e-04
dermatomyositis 1.100 7.8e-03

Gene RIF (24)

PMID Text
27025069 Computational modeling of molecular dynamics of G41R mutant form of human tyrosyl-tRNA synthetase, assosiated with Charcot-Marie-Tooth neuropathy has been presented.
26773056 Data show that the internal deletion of tyrosyl-tRNA synthetase TyrRSDeltaE2-4 splice variants (SVs) gave an alternative, neomorphic dimer interface 'orthogonal' to that of native TyrRS.
26138142 Expression of CMT-mutant tyrosyl-tRNA synthetase in Drosophila impairs protein translation.
25284223 nuclear-localized TyrRS activates transcription factor E2F1 to upregulate the expression of DNA damage repair genes such as BRCA1 and RAD51.
24907514 rhTyrRS promotes migration and aggregation of megakaryocytes to the bone marrow niche
24807208 This study presents genetic evidence for common mutant-specific interactions between two CMT-associated aminoacyl-tRNA synthetases, lending support for a shared mechanism responsible for the synthetase-induced peripheral neuropathies.
24611875 A major difference between the first- and second-generation tRNA synthetases (RSs) is that the second-generation RSs have an active site more compatible with tyrosine binding.
24354524 the association of rare YARS variant with late-onset autosomal dominant Charcot-Marie-Tooth neuropathy
23334919 The full length tyrosyl-tRNA synthetase lacks its cytokine activity because of the interactions between N-terminal and the C-terminal modules, which protect the ELR cytokine motif.
22291016 Nuclear import of TyrRS is regulated by tRNA(Tyr).
21732632 Dominant Intermediate Charcot-Marie-Tooth disorder is not due to a catalytic defect in tyrosyl-tRNA synthetase.
21442253 Naturally occurring fragments of the two proteins involved in translation, TyrRS and TrpRS, have opposing activities on angiogenesis.
19561293 Expression of tyrosyl-tRNA synthetase (YARS) DI-CMTC associated mutations (G41R, E196K,153-156delVKQV)in Drosophila leads to neuronal dysfunction.
19477417 Human tyrosyl-tRNA synthetase, where a catalytic-domain surface helix, next to the active site, was recruited for interleukin-8-like cytokine signaling.
18976975 Knockdown of tyrosyl-tRNA synthetase (YARS) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18096501 Mutating a conserved tyrosine (Y341) that tethers a critical ELR motif in TyrRS resulted in subtle opening of the structure, and activation of cytokine functions, proving the possibility of constitutive gain-of-function mutations in tRNA ligases.
17676665 HIV-1 gp120 upregulates the expression of tyrosyl-tRNA synthetase in T-cell lines
16429158 identification of two heterozygous missense mutations (G41R and E196K) and one de novo deletion (153-156delVKQV) in tyrosyl-tRNA synthetase (YARS) in three unrelated families affected with dominant intermediate Charcot-Marie-Tooth neuropathy
12427973 The structure of human mini-TyrRS containing both the catalytic & the anticodon recognition domains, is reported to a resolution of 1.18 A. The spatial disposition of the anticodon recognition domain relative to the catalytic domain is unique.
12416978 The recently discovered proangiogenic role of a tyrosyl-tRNA synthetase fragment that stimulates immune cells and links translation to a major cell-signaling pathway is discussed in this review.
12016229 the KMSSS sequence in human tyrosyl-tRNA synthetase stabilizes the transition state for the tyrosine activation reaction by interacting with the pyrophosphate moiety of ATP
11956181 role in inducing angiogenesis
11927599 replacement of second lysine in KMSKS signature sequence by potassium
11856731 role in catalyzing tyrosyl-adenylate formation

AA Sequence

MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVT      1 - 70
ILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVV     71 - 140
TQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHL    141 - 210
MNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRD    211 - 280
EKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPM    281 - 350
AKGPAKNSEPEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLV    351 - 420
VVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEK    421 - 490
LQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS                                    491 - 528
//

Text Mined References (46)

PMID Year Title
27025069 [COMPUTATIONAL MODELING OF MOLECULAR DYNAMICS OF G41R MUTANT FORM OF HUMAN TYROSYL-tRNA SYNTHETASE, ASSOSIATED WITH CHARCOT-MARIE-TOOTH NEUROPATHY].
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26773056 2016 Alternative splicing creates two new architectures for human tyrosyl-tRNA synthetase.
26138142 2015 Impaired protein translation in Drosophila models for Charcot-Marie-Tooth neuropathy caused by mutant tRNA synthetases.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25284223 2014 Oxidative stress diverts tRNA synthetase to nucleus for protection against DNA damage.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24907514 2014 Recombinant human tyrosyl-tRNA synthetase, a novel thrombopoietic agent.
24807208 2014 CMT-associated mutations in glycyl- and tyrosyl-tRNA synthetases exhibit similar pattern of toxicity and share common genetic modifiers in Drosophila.
24627108 2014 Whole-exome sequencing in patients with inherited neuropathies: outcome and challenges.
24611875 2014 Structural basis of improved second-generation 3-nitro-tyrosine tRNA synthetases.
24354524 2014 Rare variants in methionyl- and tyrosyl-tRNA synthetase genes in late-onset autosomal dominant Charcot-Marie-Tooth neuropathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23334919 2013 Asymmetric structure and domain binding interfaces of human tyrosyl-tRNA synthetase studied by molecular dynamics simulations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22291016 2012 tRNA-controlled nuclear import of a human tRNA synthetase.
21732632 2011 Dominant Intermediate Charcot-Marie-Tooth disorder is not due to a catalytic defect in tyrosyl-tRNA synthetase.
21442253 2012 Inhibition of mini-TyrRS-induced angiogenesis response in endothelial cells by VE-cadherin-dependent mini-TrpRS.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19561293 2009 Dominant mutations in the tyrosyl-tRNA synthetase gene recapitulate in Drosophila features of human Charcot-Marie-Tooth neuropathy.
19477417 2009 Mutational separation of aminoacylation and cytokine activities of human tyrosyl-tRNA synthetase.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18096501 2007 Gain-of-function mutational activation of human tRNA synthetase procytokine.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16429158 2006 Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy.
15840810 2005 Human mitochondrial TyrRS disobeys the tyrosine identity rules.
15779907 2005 Toward the full set of human mitochondrial aminoacyl-tRNA synthetases: characterization of AspRS and TyrRS.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14671330 2003 Crystal structures that suggest late development of genetic code components for differentiating aromatic side chains.
14606043 2003 Dominant intermediate Charcot-Marie-Tooth type C maps to chromosome 1p34-p35.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12509991 2003 Expression, purification, and characterization of human tyrosyl-tRNA synthetase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12427973 2002 Crystal structure of a human aminoacyl-tRNA synthetase cytokine.
12416978 2002 Activation of angiogenic signaling pathways by two human tRNA synthetases.
12016229 2002 Comparison of the catalytic roles played by the KMSKS motif in the human and Bacillus stearothermophilus trosyl-tRNA synthetases.
10438485 1999 Highly differentiated motifs responsible for two cytokine activities of a split human tRNA synthetase.
10102815 1999 Two distinct cytokines released from a human aminoacyl-tRNA synthetase.
9427763 1998 Genetic code in evolution: switching species-specific aminoacylation with a peptide transplant.
9162081 1997 Human tyrosyl-tRNA synthetase shares amino acid sequence homology with a putative cytokine.
8552597 1996 Evidence that two present-day components needed for the genetic code appeared after nucleated cells separated from eubacteria.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.