Property Summary

NCBI Gene PubMed Count 498
PubMed Score 411.72
PubTator Score 708.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 4.744 2.4
Disease Target Count Z-score Confidence
Wilson-Turner syndrome 14 4.404 2.2

Expression

  Differential Expression (24)

Disease log2 FC p
acute quadriplegic myopathy 1.077 6.8e-03
Amyotrophic lateral sclerosis 1.369 3.4e-05
atypical teratoid / rhabdoid tumor 2.300 2.8e-08
autosomal dominant Emery-Dreifuss muscul... 1.202 7.4e-03
Breast cancer 2.900 3.3e-02
breast carcinoma -1.100 8.9e-06
ductal carcinoma in situ -1.100 2.7e-03
ependymoma 2.500 2.5e-02
glioblastoma 1.600 2.2e-03
group 3 medulloblastoma -2.000 3.0e-03
interstitial lung disease -1.100 5.5e-03
invasive ductal carcinoma -1.800 1.3e-03
juvenile dermatomyositis 1.097 1.3e-06
lung carcinoma -2.200 2.3e-32
medulloblastoma, large-cell -2.200 3.1e-02
osteosarcoma 1.920 9.2e-04
ovarian cancer -2.100 2.8e-07
pancreatic cancer 2.100 1.1e-03
pediatric high grade glioma 1.400 4.6e-03
Pick disease 1.200 1.0e-02
pituitary cancer -1.300 1.2e-03
primary pancreatic ductal adenocarcinoma 2.273 4.3e-04
spina bifida -2.287 4.2e-02
subependymal giant cell astrocytoma 1.382 4.4e-03

Protein-protein Interaction (2)

PDB (14)

Gene RIF (445)

AA Sequence

MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFN      1 - 70
AVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPG     71 - 140
TLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQM    141 - 210
NVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVK    211 - 280
QPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRS    281 - 350
QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV    351 - 420
DEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVL    421 - 490
AATKLDKESFLTWL                                                            491 - 504
//

Text Mined References (515)

PMID Year Title