Property Summary

NCBI Gene PubMed Count 339
PubMed Score 335.17
PubTator Score 708.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Polycystic Ovary Syndrome 334 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 4.468 2.2

Expression

  Differential Expression (24)

Disease log2 FC p
interstitial lung disease -1.100 5.5e-03
posterior fossa group B ependymoma 2.700 7.0e-17
glioblastoma 1.600 2.2e-03
osteosarcoma 1.966 4.0e-04
atypical teratoid / rhabdoid tumor 2.400 6.0e-09
medulloblastoma, large-cell -2.200 3.1e-02
autosomal dominant Emery-Dreifuss muscul... 1.202 7.4e-03
juvenile dermatomyositis 1.097 1.3e-06
Amyotrophic Lateral Sclerosis 1.369 3.4e-05
acute quadriplegic myopathy 1.077 6.8e-03
primary pancreatic ductal adenocarcinoma 2.273 4.3e-04
breast carcinoma -1.100 8.9e-06
Breast cancer 2.900 3.3e-02
pediatric high grade glioma 1.400 4.6e-03
group 4 medulloblastoma -3.200 1.4e-06
subependymal giant cell astrocytoma 1.382 4.4e-03
lung carcinoma -2.200 2.3e-32
spina bifida -2.287 4.2e-02
Pick disease 1.200 1.0e-02
ductal carcinoma in situ -1.100 2.7e-03
invasive ductal carcinoma -1.800 1.3e-03
ovarian cancer -2.100 2.8e-07
pituitary cancer -2.100 2.5e-06
pancreatic cancer 2.100 1.1e-03

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
743488 summary 0 / 0 / 0 Broad Institute Identification of Selective YAP1 Small Molecule Inhibitors Inhibitor Probe Project

Gene RIF (297)

PMID Text
26986510 the Cdc42/Nwasp/stress fibers/YAP signal pathway may potentially play an important role in regulating podocyte apoptosis. Maintaining necessary Cdc42 would be one potent way to prevent proteinuria kidney diseases.
26967905 treatment with Verteporfin, an inhibitor of YAP transcriptional activity, partially rescued the 3D spheroid defects of Nek8-invalidated cells and the abnormalities of NEK8-overexpressing zebrafish embryos
26944315 Nuclear accumulation of YAP could promote the survival of senescent cells by increasing survivin expression.
26923924 we demonstrate that NF2 negatively controls the invasiveness of Glioblastoma multiforme through YAP-dependent induction of CYR61/CCN1 and miR-296-3p.
26876920 A direct interaction of ZEB1 with the Hippo pathway effector YAP, in which ZEB1 switches its function to a transcriptional co-activator of a 'common ZEB1/YAP target gene set', links two pathways with similar cancer promoting effects.
26791271 This study suggests that ROCK/YAP/Egr-1 signaling regulates tissue factor expression after stimulation with lipopolysaccharide in endothelial cells.
26759237 RASSF1 acts to restrict EMT and invasion by indirectly controlling YAP nuclear shuttling.
26691213 YAP physically interacts with mutant p53 proteins in breast cancer cells and potentiates their pro-proliferative transcriptional activity.
26678338 MYC-driven change in mitochondrial dynamics limits YAP/TAZ function in mammary epithelial cells and breast neoplasms.
26671411 The SRF-IL6 axis is the critical mediator of YAP-induced stemness in mammary epithelial cells and breast cancer.
26668310 define an endothelial cell mechano-signaling pathway in which a cryptic collagen epitope activates alphavbeta3 leading to an Src and p38 MAPK-dependent cascade that leads to nuclear accumulation of Yes-associated protein (YAP)
26668268 Actin remodeling confers BRAF inhibitor resistance to melanoma cells through YAP/TAZ activation
26634820 SerpinB3 indirectly increased the transcription of Myc through the induction of Yap pathway.
26617849 The level of YAP expression varies according to the metastatic site in metastatic breast cancer. High YAP expression was correlated with poor prognosis.
26611634 It YAP plays an essential role in amino acid-induced mTORC1 activation, particularly under nutrient-limiting conditions.
26598551 study reports for the first time that USP9X is a deubiquitinase of Angiomotin-like 2 (AMOTL2) and that AMOTL2 mono-ubiquitination is required for YAP inhibition
26575609 In conclusion, Fat4 expression is deceased in gastric cancer cells, leading to nuclear translocation of Yap and correlates with poor prognosis.
26574480 YAP is involved via the Hippo pathway in regeneration and fibrogenesis after ischaemic acute kidney injury.
26572166 These data suggested that the YAP acts synergistically to promote pancreatic cancer progression by hyperactivation of AKT signaling.
26567630 YAP may be involved in pancreatic tissue regeneration, and that deregulation of these proteins may play a role in neoplastic transformation and stellate cell functions in both PDAC and pancreatitis.
26549256 Distinct RASSF1 isoforms have opposing functions, which provide a biomarker for YAP1 activation and explain correlations of RASSF1 methylation with advanced invasive disease in humans.
26459764 Myocardin-Related Transcription Factor A and Yes-Associated Protein Exert Dual Control in G protein-coupled receptor- and RhoA-mediated transcriptional regulation and cell proliferation
26458763 YAP1 is a regulator of myofibroblast differentiation and contributes to the maintenance of a synthetic and contractile phenotype, in both transforming growth factor-beta1-induced myofibroblast differentiation and primary Dupuytren myofibroblasts.
26439301 YAP/TAZ regulate transcriptional elongation from the enhancer elements by recruiting the Mediator complex and promoting phenotypes of overgrowth and tumorigenesis.
26432639 This study identifies a novel mechanism of TAZ regulation by YAP, which has significant implications for our understanding of Hippo pathway regulation, YAP-isoform specific signaling, and the role of these proteins in cell proliferation, apoptosis, and tumorigenesis.
26426694 Decreased Yes-Associated Protein-1 expression is associated with heart Ventricular Septal Defects
26420216 these studies demonstrate that TAZ and YAP exhibit different functional roles in hepatocellular carcinoma progression, including chemoresistance and tumorigenicity
26417066 Human papillomavirus type 16 E6 protein, a major etiological molecule of cervical cancer, maintains high YAP protein levels in cervical cancer cells by preventing proteasome-dependent YAP degradation to drive cervical cancer cell proliferation.
26359368 NF2/merlin inactivation augments mutant RAS signaling by promoting YAP/TEAD-driven transcription of oncogenic and wild-type RAS, resulting in greater MAPK output and increased sensitivity to MEK inhibitors.
26327812 Extracellular pH can modulate cell proliferation and apoptosis by regulating the proton-sensing G-protein-coupled receptor-YAP pathway.
26316081 Exogenous over-expression of YAP1 partially eliminated miR-497-induced cell growth.
26315483 study reveals that activation of YAP strongly activates its upstream inhibitors Lats1/2 kinases, thus establishing a previously unknown negative feedback mechanism of the Hippo pathway.
26299613 FOXM1 is regulated by LPA and YAP oncogenic signaling pathways in high grade serous ovarian cancer
26295846 YAP1 largely exerts its transcriptional control via distal enhancers that are marked by H3K27 acetylation.
26276632 Study discovered Ythat AP/TAZ are bona fide downstream effectors of the alternative Wnt signaling pathway.
26272168 The YAP signaling is sustained through a novel microRNA-dependent positive feedback loop.
26263504 Both overall and nuclear YAP1 overexpression are intimately associated with adverse OS and DFS in numerous cancers.
26254048 YAP expression in human hepatocellular carcinoma cell lines MHCC97H and MHCC97L is closely related with the characteristic markers of epithelial-mesenchymal transition
26239136 Results suggest that miR-138 is a tumor suppressor miRNA in oral squamous cell carcinoma cells through targeting YAP1.
26173433 show that the proangiogenic microfibrillar-associated protein 5 (MFAP5) is a direct transcriptional target of YAP/TEAD in cholangiocarcinoma cells
26169195 Results provide an insight into a model of coordinating endothelial junctional stability and angiogenic activation through YAP.
26163939 Our results emphasize the importance of YAP1 and H19 in bladder cancer progression and indicate that H19, at least in part, is induced by YAP1 overexpression
26136233 Compelling preclinical evidence showed that TAZ/YAP are often aberrantly engaged in breast cancer, where their hyperactivation culminates into a variety of tumor-promoting functions. (Review)
26126522 Gene transcription and protein expression of YAP may be involved in the development of androgenresistant prostate cancer, and may be a novel biomarker for investigation of the occurrence and progression of androgenresistant prostate cancer.
26124339 Nuclear YAP and cytoplasmic beta-catenin play important roles in carcinogenesis.
26119935 results suggest that YAP activation exerts a protective role and represents a pharmacological target to enhance the anti-tumor effects of DNA damaging modalities in the treatment of UCC
26096363 The results indicate that miR-132 could inhibit the growth of hepatoma cells by targeting YAP gene and reducing its expression level.
26058078 ERG activates the transcriptional program regulated by YAP1 of the Hippo signaling pathway and found that prostate-specific activation of either ERG or YAP1 in mice induces similar transcriptional changes and results in age-related prostate tumors.
26056182 Results implicate YAP1 R331W as an allele predisposed for lung adenocarcinoma with high familial penetrance.
26039999 Netrin-1 stimulates phosphatase 1A to dephosphorylate YAP, which leads to decreased ubiquitination and degradation, enhancing YAP accumulation and signaling
26025096 Our findings indicate that YAP is a negative regulator of chondrogenic differentiation of mesenchymal stromal/stem cells
26015398 YAP promotes carcinogenesis and metastasis in cholangiocarcinoma
25998128 mTORC2-mediated phosphorylation of AMOTL2 blocks its ability to inhibit YAP signaling.
25973055 our current data indicated a new regulatory mechanism of YAP1 by the LATS2-mediated phosphorylation that was involved in hepatocellular carcinoma tumorigenesis.
25971581 High levels of YAP is associated with gastric cancer.
25962877 These findings implicate YAP as a critical regulator in angiogenesis and provide new insights into the mechanism coordinating junctional stability and angiogenic activation of endothelial cells.
25955651 The results suggested that GNAQ mutation induced viability and migration of uveal melanoma cells via Notch signaling activation, which is mediated by YAP dephosphorylation and nuclear translocation.
25936800 The Wnt3a/beta-catenin and Activin/SMAD2,3 pathways act in concert to counteract YAP repression and upregulate mesendoderm genes during early embryonic stem cell differentiation.
25915126 Suggest central role for TEAD and YAP as signal-responsive regulators of multipotent pancreatic progenitors.
25908270 YAP activation is a critical driver of hepatic stellate cell activation
25895125 In ovarian cancer cells, miR-129-5p, directly represses YAP expression, leading to the inactivation of TEA domain transcription, and the downregulation of Hippo downstream genes, connective tissue growth factor and Cyclin A.
25849865 Cytoplasmic retention of YAP/TAZ correlates with active ciliogenesis. knockdown of YAP/TAZ is sufficient to induce ciliogenesis, whereas YAP/TAZ hyperactivation suppresses serum starvation-mediated ciliogenesis.
25846731 our study demonstrates that miR-506 may act as a tumor suppressor in gastric cancer(GC) and that the miR-506/Yap1 axis may help us better understand the molecular mechanisms of GC progression.
25846049 Data shows that translocation of YAP induced acquired resistance to cisplatin in oral squamous cell carcinoma.
25843714 Our demonstration of the transcriptional co-repressor activity of YAP/TAZ opens a new avenue for understanding the Hippo signaling pathway.
25811979 our data reveal a role for YAP in promoting breast cancer cell survival upon ND stress and uncover an unappreciated function of YAP/TEAD in the regulation of autophagy.
25794680 The study defines a YAP/TAZ-regulated transcriptional program in oral squamous cell carcinoma and reveals novel roles for nuclear YAP/TAZ activity in the onset and progression of this cancer.
25772246 High YAP1 expression is associated with breast neoplasms.
25754111 YAP1 regulates OCT4 activity and SOX2 expression to facilitate self-renewal of stem-like cell
25751140 cellular energy stress induces YAP phosphorylation, in part due to AMPK-dependent Lats activation, thereby inhibiting YAP activity.
25750037 YAP1 can be used as a diagnostic marker for gliomas to monitor the disease status and may help to evaluate its treatment effects. More functional experiments are needed to support the direct roles of YAP1 on gliomas at molecular and cellular levels.
25743273 YAP1 was confirmed to be a functional target of miR-15a and miR-16-1 in GAC.
25739674 Our data provide evidence that YAP1 upregulation of EGFR plays an important role in conferring therapy resistance in esophageal cancer cells. Targeting YAP1-EGFR axis may be more efficacious than targeting EGFR alone in esophageal cancer.
25727017 the S-hairpin within YAP mRNA 3'UTR may serve as a novel regulatory element, which functions in regulation at post-transcription level
25691658 YAP regulates the expression of HOXA1 and HOXC13 in human keratinocytes.
25658431 Sub-cellular localisation studies may spuriously detect the Yes-associated protein, YAP, in nucleoli
25652178 Data shows that YAP and Taz play important roles in organ size control and normal tissue regeneration and there expression is upregulated in many human cancer. [review]
25645929 YAP knockdown greatly reduced the rates of migration and invasion of LNCaP-C4-2 cells and under androgen deprivation conditions largely blocked cell division in LNCaP-C4-2 cells.
25636199 The study identified monoacylglycerol lipase as a YAP transcriptional target and an inhibitor of anchorage-dependent cell growth.
25635998 These findings thus provide insight into the molecular mechanisms by which YAP regulates cell cycle progression.
25628125 Our findings suggest that genetic variants of Hippo pathway genes, particularly YAP1 rs11225163, TEAD1 rs7944031 and TEAD4 rs1990330, may independently or jointly modulate survival of CM patients.
25625370 These results demonstrated that as an inhibitor of YAP, LATS1 was decreased via downregulation of YAP using RNAi. This therefore indicated that the change in YAP levels in hepatocellular carcinoma cells may regulate LATS1 in a feedback manner.
25607725 YAP may be a bridging molecule between NSCLC growth and its mechanical microenvironment, and that it may regulate the growth of NSCLC in response to matrix stiffness.
25607641 these results are relevant to understand of YAP function and open the door to the design of highly specific ligands of interest to delineate the functional role of each WW domain in YAP signaling.
25605730 YAP constitutively associated with BubR1 (BUB1-related protein kinase), and knockdown of BubR1 relieved YAP-driven hyperactivation of the spindle checkpoint.
25605020 CD44 functions as an upstream regulator sensing the extracellular environment to modulate ERK, AKT and Hippo-YAP pathways which cooperatively control downstream gene expression to modulate breast cancer cell contact inhibition of proliferation.
25592648 this article summarizes the current understanding of the biological functions of YAP and TAZ, and how the regulation of these two proteins can be disrupted in cancer.[Review]
25516090 Our findings suggest that YAP could play a role in PM growth.
25502501 Immortalized fibroblasts conditionally expressing active YAP or TAZ mutant proteins overcome soft matrix limitations on growth and promote fibrosis
25492965 These observations connect the unusual nuclear function of a growth factor receptor with a mechanosensory pathway and suggest that NRG1-ERBB4-YAP signaling contributes to the aggressive behavior of tumor cells.
25492964 identifying neuregulin 1 and its cognate receptor ERBB4 [epidermal growth factor receptor (EGFR) family member v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4] as a major receptor complex that activates YAP activity
25473897 Data show that fibroblast growth factor 8 (FGF8) can activate YAP1 (Yes-associated) protein signaling in colorectal cancer (CRC).
25438054 YAP complexes with HIF1alpha and is essential for HIF1alpha stability and function in tumours in vivo.
25436413 these observations reveal that Itch and Yap1 have antagonistic roles in the regulation of ASPP2 protein stability through competing post-translational regulatory mechanism of ASPP2.
25425573 Conversely, increased expression of betaPIX in breast cancer cell lines re-couples the Hippo kinase cassette to Yap/Taz, promoting localization of Yap/Taz to the cytoplasm and inhibiting cell migration and proliferation.
25404446 SIRT1 was overexpressed in HCC and the expression was positively related to P53 and YAP2 expression.
25393475 The control of LATS activation by angiotensin II and subsequent YAP localization is important for podocyte homeostasis and survival.
25388162 Activation of YAP1 is highly associated with poor prognosis for colorectal cancer.
25384421 the YAP-TEAD interaction can be disrupted using cyclic YAP-like peptides, which targets the HIPPO pathway
25360797 ASPP2 directly induces the dephosphorylation and activation of junctional YAP
25344213 the YAP expression in metaplastic carcinoma is higher than that in TNBC, representing the association of stemness and epithelial-mesenchymal transition features in metaplastic carcinoma.
25337244 Expression level of YAP in stromal component was increased along with histologic grade of breast phyllodes tumor and YAP expression in PT was related to tumor progression and poor prognosis.
25304677 High expression of Yes-associated protein is associated with cervical squamous epithelium lesions.
25290150 YAP, TAZ and HSP90 take part in contact guidance and intercellular junction formation in corneal epithelial cells.
25288394 the regulation of YAP by mTOR and autophagy is a novel mechanism of growth control, matching YAP activity with nutrient availability under growth-permissive conditions.
25283809 data show that the WW tandem domains of YAP2 negatively cooperate when binding to their cognate ligands
25270913 both LATS1 demethylation and overexpression of LATS1 downregulated the expression of Yes-associated protein (YAP), inhibited cell proliferation, induced cell apoptosis and cell cycle G1 arrest in 786-O cells
25261601 The close relationship between Runx2 and YAP plays a pro-carcinogenetic role in liver cancer cells through inhibiting tumor suppressor lncRNA, MT1DP in a FoxA1 dependent manner.
25218593 The activation of the AXL/MAPK pathway was involved in the oncogenic functions of YAP1 in GBC.
25201954 Substratum-induced differentiation of human pluripotent stem cells reveals the coactivator YAP is a potent regulator of neuronal specification.
25180228 the oncogenic activity of Ras(V12) depends on its ability to counteract Hippo pathway activity, creating a positive feedback loop, which depends on stabilization of YAP1.
25175178 Expression of YAP mRNA and protein in clear cell renal carcinoma tissues was higher than in adjacent normal tissue. YAP knockdown inhibited cell proliferation and induced cell cycle arrest and apoptosis.
25168380 Our findings define the alteration of the Hippo/YAP pathway in the development of hypertrophic cardiomyopathy
25127217 Cyclic stretch is associated with a JNK-dependent increase in binding of a LATS inhibitor, LIMD1, to the LATS1 kinase and that reduction of LIMD1 expression suppresses the activation of YAP by cyclic stretch.
25122798 shows how this association of small t antigen with YAP is important for its effects on cell phenotype. It also suggests that PyST can be used to characterize cellular processes that are regulated by YAP
25115923 YAP inhibits squamous transdifferentiation of Lkb1-deficient lung adenocarcinoma through ZEB2-dependent DNp63 repression.
25101858 data are presented showing that CD44 could act through RhoA signaling to regulate YAP expression
25087998 YAP mRNA might be one of the targets of miR-506.
25087979 YAP1 is a potent embryonal rhabdomyosarcoma oncogenic driver.
25078107 TAZ and YAP are differentially regulated by hypoxia in cancer cells
25031743 there was a significant difference in YAP and phosphorylated YAP expression status according to molecular subtypes and tumoral and cellular components of breast cancers.
24993351 Results show that YAP1 is highly expressed in human osteosarcoma suggesting an important regulator role in osteosarcoma tumorigenesis.
24972085 Increased nuclear YAP expression was significantly associated with higher grade, stage and radiation sensitivity in endometrial cancer. YAP overexpression promoted cell proliferation in vitro.
24954536 Using a colon cancer cell line, study found 147 genes that promoted survival upon KRAS suppression. In particular, the transcriptional coactivator YAP1 rescued cell viability in KRAS-dependent cells upon suppression of KRAS and was required for KRAS-induced cell transformation.
24906622 Findings identify YAP1-driven SOX9 expression as a critical event in the acquisition of cancer stem cell properties in esophageal cancer.
24884509 Fbxw7 induces apoptosis and growth arrest by regulating YAP abundance in hepatocellular carcinoma.
24881775 Hippo and Yap regulated cardiomyocyte death and regeneration.[review]
24860833 The expression of YAP was significantly correlated with Edmondson stage, serum AFP level, and hepatocellular carcinoma prognosis.
24837480 beta-catenin and the transcriptional regulator Yap1 interact physically and are activated in most human hepatoblastoma tissues; overexpression of activated forms of these proteins in livers of mice leads to rapid tumor development.
24833660 Cardiac-specific YAP activation after myocardial infarction mitigated myocardial injury, improved cardiac function, and enhanced survival.
24813251 Low YAP1 levels prevent nuclear ABL1-induced apoptosis in hematologic malignancies.
24810989 YAP1 acts as oncogenic target of 11q22 amplification in multiple cancer subtypes.
24810048 Report coordinated control of chaetocin treated glioma cell proliferation and metabolism by ROS through (i) ATM-YAP1-driven apoptotic pathway and (ii) JNK-regulated metabolic adaptation.
24806962 Human myoblasts with LMNA mutations have mechanosensing defects through a YAP-dependent pathway.
24803537 findings identified Yap as a critical oncogenic KRAS effector and a promising therapeutic target for PDAC and possibly other types of KRAS-mutant cancers
24779718 MIR31 significantly suppressed the luciferase activity of mRNA combined with the LATS2 3'-UTR and consequently promoted the translocation of YAP1, a key molecule in the Hippo pathway, into the nucleus
24728461 Mechanistic studies revealed a multi-targeted mechanotransductive process involving Smad phosphorylation and nucleocytoplasmic shuttling, regulated by rigidity-dependent Hippo/YAP activities and actomyosin cytoskeleton integrity and contractility.
24726915 ANKHD1 is a positive regulator of YAP1 and promotes cell growth and cell cycle progression through Cyclin A upregulation.
24703331 In melanoma, Hippo signaling is affected by copy number alterations and YAP1 overexpression impairs patient survival.
24682895 NSCLC cell lines in which LATS1 was either overexpressed or depleted confirmed that LATS1 markedly inhibited cell proliferation and invasion and could regulate the nuclear location of yes-associated protein (YAP).
24648515 Nuclear TAZ/YAP also cooperate with TGFbeta signaling to promote phenotypic and transcriptional changes in nontumorigenic cells to overcome TGFbeta-repressive effects.
24643316 Overexpression of YAP1 is correlated with progression and metastasis in gastric carcinoma.
24622501 YAP promotes ovarian cancer cell growth and tumorigenesis
24621512 nicotine activated nAChRs signaling pathway which further activates YAP1 plays an important role in the development of esophageal cancer
24606817 a role of YAP as a suppressor gene in breast cancer (BC); showed differences in YAP expression in different patterns of ductal BC.
24559095 Decreased YAP1 expression is an independent prognostic factor for recurrence in less aggressive luminal A breast cancer subgroup.
24558021 Tumor cell proliferation in human schwannomas is linked to a signaling network controlled by the Hippo effector YAP.
24511017 Activation of YAP1 is significantly associated with prognosis and the YAP1 signature can predict response to taxane-based adjuvant chemotherapy in patients with ovarian cancer.
24482231 this work summarizes a novel link between CD166 and YAP, explores the interplay among related important signaling pathways, and may lead to more effective therapeutic strategies for liver cancer.
24468535 Overexpression of YAP induced the translocation of itself and SRSF1 and was independent of LATS.
24462371 Heterozygous loss-of-function mutations in YAP1 cause both isolated and syndromic optic fissure closure defects.
24389730 YAP regulates cell proliferation, migration, and steroidogenesis in adult granulosa cell tumors
24380865 The PDZ-binding motif of YAP is critical for YAP-mediated oncogenesis, and that this effect is mediated by YAP's co-activation of TEAD-mediated CTGF transcription.
24369055 results suggest that E2A suppresses CRC cell metastasis, at least partially if not all, by inhibiting YAP expression
24367099 RHAMM transcription is regulated via YAP in a pathway involving mevalonate and Hippo that modulates breast cancer cell motility
24362629 identification of a signalling axis that links YAP activation with LKB1 mutations, and implications for the treatment of LKB1-mutant human malignancies; in addition, findings provide insight into upstream signals of the Hippo-YAP signalling cascade
24346160 Studies indicate that yes-associated protein (YAP)-1 plays a dual role as oncogene and tumor suppressor gene in oncogenesis, depending on the specific tissue type involved.
24324261 post-transcriptional regulation of Dicer is controlled by the cell density-mediated localization of the Hippo pathway effectors TAZ (transcriptional co-activator with PDZ-binding motif) and YAP (Yes-associated protein) (TAZ/YAP).
24323901 YES1 and YAP transcript levels were higher in liver metastases of patients with colon cancer after 5FU-based neoadjuvant chemotherapy.
24268772 Patients with diverse biliary dysfunctions exhibit enhanced IQGAP1 and nuclear YAP expression.
24242138 SiRNA targeting YAP1 significantly inhibits growth and induces apoptosis in pancreatic ductal adenocarcinoma cells
24223879 Data indicate that when compared with level of yes-associated protein 1 (YAP1) mRNA expression of the AA genotype, the mRNA expression level in CC genotype was statistically lower.
24211253 MEK1-YAP interaction is critical for liver cancer cell proliferation and maintenance of transformed phenotypes both in vitro and in vivo.
24115727 Phosphorylation of Yes-associated protein-1 is associated with Wilms tumor.
24106282 combined genetic association studies in women from China/Netherlands/United States: Data suggest that an SNP in YAP1 (rs1894116) and SNPs in other proteins are associated with polycystic ovary syndrome across ethnic differences. [META-ANALYSIS]
24101513 Data indicate that the phosphorylation of Amot130 by LATS1/2 is found to be a key feature that enables it to inhibit Yes-associated protein (YAP) dependent signaling and cell growth.
24101467 Data indicate that Yap1 is epigenetically regulated by menin and correlated with poor prognosis in hepatocellular carcinoma.
24101154 A previously unrecognized mechanism for controlling the activity of YAP that is crucial for its oncogenic function mediated by mitotic dysregulation.
24086533 Increased YAP1 expression was more frequently found in combined hepatocellular-cholangiocarcinoma and hepatocellular carcinoma with stemness than in HCCs without, and a YAP1 pathway may be involved in the stemness characteristics in HCCs and cHC-CCs.
24023255 A molecular mechanism linking JNK activity to Yki regulation. JNK can promote YAP activity in mammalian cells.
24003254 Within the nucleus, Amot-p130 was associated with the transcriptional complex containing Yap and Teads (TEA domain family members) and contributed to the regulation of a subset of Yap target genes, many of which are associated with tumorigenesis.
24003252 Scaffold proteins angiomotin (Amot) and angiomotin-related AmotL1 and AmotL2 were recently identified as negative regulators of YAP and TAZ by preventing their nuclear translocation.
23994632 These results establish a new signaling mechanism by which the interaction between YAP and c-Myc promotes liver cancer growth.
23994529 identified an intronic region of the NAIP gene responding to TEAD1/YAP activity, suggesting that regulation of NAIP by TEAD1/YAP is at the transcriptional level
23949920 data indicate that nuclear YAP localization is more common in breast cancers lacking functional adherens junctions, it suggests that YAP-mediated transcription may be involved in the development and progression of invasive lobular breast cancer.
23897276 Both YAP and TAZ contribute to the invasive and metastatic capacity of melanoma cells.
23870412 YAP 1 is an independent biomarker for poor prognosis of patients with urothelial carcinoma of the bladder
23762387 Overexpression of YAP is associated with metastasis in colorectal cancer.
23760493 YAP functions as a tumor suppressor that enhances apoptosis by modulating p53 during chemotherapy.
23737213 In summary, we are reporting a novel subset of EHE occurring in young adults, showing a distinct phenotype and YAP1-TFE3 fusions.
23727052 In conclusion, substratum stiffness alters YAP/TAZ expression and YAP localization in trabecularmeshwork cells which then may modulate the expression of extracellular matrix proteins important in glaucoma.
23685355 YAP1 was downregulated in medullary thyroid carcinoma.
23673988 results suggest that the expression of YAP and phosphorylated YAP is a possible predictor of tumor cell proliferation and prognosis in colorectal adenocarcinoma
23667252 YAP binding to dendrin is a prosurvival mechanism in podocytes.
23613971 Data demonstrate that PTPN14 downregulation can phenocopy YAP activation in mammary epithelial cells and synergize with YAP to induce oncogenic transformation.
23594797 These findings provide mechanistic insight into the regulation of YAP and AREG by RASSF1A in human multistep hepatocarcinogenesis.
23576552 Data indicate that knockdown of TEAD1/3/4 induces an almost identical cellular senescent phenotype as YAP silencing.
23564455 Amot130 repurposes AIP4 from its previously described role in degrading large tumor suppressor 1 to the inhibition of YAP and cell growth.
23558963 results indicated that YAP overexpression contributed to the tumorigenesis and played a pivotal role in the progression in colorectal cancer
23544078 High Yap activity in muscle fibres does not induce fibre hypertrophy nor fibre type changes but instead results in a reversible atrophy and deterioration.
23542177 findings reveal a new regulatory mechanism of YAP2 by the SIRT1-mediated deacetylation that may be involved in HCC tumorigenesis and drug resistance
23532963 Mutual interaction between YAP and CREB promotes tumorigenesis in liver cancer.
23527718 YAP1 is highly expressed in osteosarcoma tissue, and knockdown of YAP1 resulted in downregulation of RUNX2, CyclinD1, and MMP-9 and inhibited the proliferation and invasion of MG-63 cells
23502453 YAP1 has oncogenic potential in cervical cancer with distinct functions in squamous cell carcinomas and adenocarcinoma.
23422184 YAP1 is involved in the carcinogenesis and development of OSCC. There is a transformation between nucleus and cytoplasm.
23340296 we found that YAP1 expression was inversely correlated with miR-200a expression in breast cancer clinical specimens, and miR-200a expression was associated with distant metastasis in patients with breast cancer.
23333315 Mask proteins are functionally conserved between Drosophila and humans and are coexpressed with YAP in a wide variety of human stem/progenitor cells and tumors.
23333314 MASK1 complexes with YAP and is required for the full activity of YAP.
23298489 Spearman rank correlation analysis showed a positive correlation between YAP1 and Axl expression
23298488 YAP1 is highly expressed in gastric cancer tissues compared with the dysplasia and chronic gastritis tissues and its expression level is elevated with the ascending order of tumor malignancy.
23245941 beta-catenin forms a complex with YAP1 and TBX5, which promotes colon cancer cell survival and contributes to malignant transformation. These observations reveal hitherto unidentified components of the beta-catenin pathway that play key roles in survival of beta-catenin-active cells.
23232767 we provide evidence that YAP overexpression plays an important role in the chemoresistance of hepatocellullar carcinoma cells to doxorubicin.
23178811 yes-associated protein 1 (YAP; also known as YAP1)--a protein known for its powerful growth-inducing and oncogenic properties--has an unexpected growth-suppressive function, restricting Wnt signals during intestinal regeneration
23158133 Over-expression of YAP was associated with non-small cell lung cancer, especially lung adenocarcinoma.
23060277 study reveals that GPC3 promotes the growth of hepatocellular carcinoma (HCC) by increasing cell proliferation, enhancing metastasis as well as invasion; GPC3 may collaborate with YAP to regulate the HCC development
23058008 YAP is strongly expressed in gastric adenocarcinomas, and knockdown of YAP may inhibit gastric cancer cell proliferation and metastasis.
23027379 In this review, we will discuss the points of intersection between the Wnt/beta-catenin and Hippo/YAP pathways and how these interactions contribute to homeostasis, organ repair, and tumorigenesis.
23027127 LKB1 inhibited Yap independently of either AMPK or mTOR activation
22993325 The nuclear overexpression of YAP1 is an independent biomarker for poor survival, especially for patients with intestinal-type gastric cancer.
22948661 that PTPN14 acts to suppress cell proliferation by promoting cell density-dependent cytoplasmic translocation of YAP1
22895435 Studies indicate that the transcriptional co-activators YAP and TAZ recently emerged as key mediators of the biological effects that are observed in response to extracellular matrix (ECM) elasticity and cell shape.
22843909 YAP expression failed to produce any significant relationship with the overall survival rate. CONCLUSION: YAP expression is not an independent prognostic factor in patients with breast cancer.
22707013 YAP is a key driver gene in Hepatitis B virus X protein-induced hepatocarcinogenesis in a cyclic adenosine monophosphate response element-binding protein-dependent manner.
22689061 YAP forms a protein complex with PTPN14 through the WW domains of YAP and the PPXY motifs of PTPN14.
22632819 YAP promotes breast cell proliferation and survival partially through stabilizing the KLF5 transcription factor.
22618028 these findings suggest that in meningiomas, deregulation of the Hippo pathway is largely observed in primary tumors and that YAP1 functions as an oncogene promoting meningioma tumorigenesis.
22609549 crosstalk between the insulin/IGF signaling pathway and Yorkie leads to coordinated regulation of these two oncogenic pathways in hepatocellular carcinoma
22558212 YAP1, excluded from the nucleus, contributes to the maintenance of tight junctions.
22544757 analysis of a novel acetylation cycle of transcription co-activator Yes-associated protein that is downstream of Hippo pathway is triggered in response to SN2 alkylating agents
22499345 Identification of a new susceptibility gene YAP1 on chromosome 11q13 for polycystic ovary syndrome.
22436626 Our findings suggested that Yes-associated protein contributes to primary liver tumorigenesis and likely mediates its oncogenic effects through modulating Survivin expression.
22396793 YAP1 is overexpressed in pancreatic cancer tissues and potentially plays an important role in the clonogenicity and growth of pancreatic cancer cells
22337891 these results implicate YAP as an oncogene whose expression is driven by aberrant Wnt/beta-catenin signaling in human colorectal carcinoma cells.
22308035 The coactivator activity of YAP correlated with its state of phosphorylation and sensitivity to cisplatin-induced apoptosis.
22286761 YAP activation in the mesothelioma cells promotes cell cycle progression by upregulating transcription of cell cycle-promoting genes.
22234184 The authors show that YAP and TAZ, the transcriptional co-activators in the Hippo pathway, suppress Wnt signalling without suppressing the stability of beta-catenin but through preventing its nuclear translocation.
22098159 Yap induction mediated by inactivation of Lats is observed in hepatic malignancies.
22096589 YAP expression, in combination with p63 can facilitate identification of HNSCC tumors from hyperplastic and benign tissues and the metastatic function of YAP in HNSCC may not be a result of epithelia to mesenchymal transdifferentiation.
22056638 Breast cancer cell lines in which YAP was either overexpressed or depleted confirmed that YAP markedly promotes cell proliferation
22042863 Data show that Yap is overexpressed in 68 of 71 colon cancers and in at least 30 of 36 colon cancer-derived cell lines.
22024089 results of the qRT-PCR and western blotting showed an obvious inhibition of YAP mRNA and protein expression in the YAP-shRNA group
22012126 liver regeneration alone elevated YAP protein levels without elevating YAP mRNA levels. YAP mRNA and protein levels were both elevated in liver cancer cells
21981024 The WW1 and WW2 domains of YAP2 recognize various PPXY motifs within WBP1 and WBP2 in a highly promiscuous and subtle manner.
21909427 These findings define a novel molecular mechanism that YAP2 is positively regulated by PP1-mediated dephosphorylation in the cell survival.
21874045 Our results establish a central role for YAP in counteracting radiation-based therapies and driving genomic instability, and indicate the YAP/IGF2/Akt axis as a therapeutic target in medulloblastoma.
21856745 the transcriptional coactivator YAP1 was determined to be a direct target of miR-375 in lung cancer cells
21800344 Expression of CTGF can be stimulated through the EGFR-signaling system in HCC cells in a novel cross-talk with the oncoprotein YAP
21708480 study shows that YAP could promote cell proliferation by activating transcription factor Fra-1 in oral squamous cell carcinoma.
21685940 AmotL1 and ZO-2 are two candidates that could be harnessed to control the oncogenic function of YAP.
21666501 This study demonistrated taht the YAP1 overexpression promotes growth of glioblastoma cell lines in vitro.
21654799 findings identify YAP/TAZ as sensors and mediators of mechanical cues instructed by the cellular microenvironment
21610251 alphaE-catenin as a tumor suppressor that inhibits Yap1 activity and sequesters it in the cytoplasm.
21454516 AGR2 induction of AREG is mediated by activation of the Hippo signaling pathway co-activator, YAP1.
21399893 YAP may act as a tumor suppressor in invasive breast carcinomas and it can also be used as a molecular marker for ER and PR negative breast tumors.
21364637 JNK1 and JNK2 were identified as robust YAP kinases.
21346147 Data suggest that YAP1 could be a prognostic biomarker and potential therapeutic target for gastric cancer.
21317925 findings suggest that YAP derepression contributes to the genesis of ovarian clear cell carcinoma and that the SWH pathway is an attractive therapeutic target
21224387 novel mechanism to restrict the activity of TAZ and YAP through physical interaction with Amot and AmotL1
21205866 a novel mechanism of YAP and TAZ inhibition by AMOT-mediated tight junction localization
21187284 a new mechanism for YAP1 regulation, which is mediated via its direct interactions with angiomotin-like proteins.
21170084 a previously unrecognized link between BMI-1, contact inhibition and the Hippo-YAP pathway
21118971 Results suggest that YAP1 may play an important role in prognosis of small-cell lung cancer patients treated with platinum-based chemotherapy.
21112960 Overexpression of YAP protein was associated with esophageal squamous cell carcinoma.
21076472 AXL is a mediator of YAP-dependent oncogenic activities
21041411 Data show that ASPP1 enhances nuclear accumulation of YAP/TAZ and YAP/TAZ-dependent transcriptional regulation.
20947521 Overexpression of Yap2 and phosphorylation-defective Yap2-5SA is associated with ovarian cancer.
20868367 translocation of YAP2 to nucleus requires complexation with ZO-2; PDZ domains on both proteins are involved in complex formation; YAP2/ZO-2 complex appears to be involved in cell detachment
20842732 data suggest that the amplification and overexpression of YAP1 and VGLL3 could be involved in oncogenesis and progression of soft tissue sarcomas
20823509 14-3-3sigma has been cloned, purified and crystallized in complex with a phosphopeptide from the YAP 14-3-3-binding domain, which led to a crystal that diffracted to 1.15 A resolution.
20729916 YAP function as a tumor suppressor may alternatively be dysregulated by AKT phosphorylation at serine-127 and cytoplasmic sequestration, or by transcriptional repression by DeltaNp63, in different subsets of head and neck squamous cell carcinomas (HNSCCs).
20677011 that YAP1 overexpression in primary human keratinocytes blocks clonal evolution and induces cell immortalization, but not malignant transformation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20226166 miR-375 is an important regulator of YAP oncogene playing the role in hepatocellular carcinoma development.
20219076 YAP plays an important role in NSCLC and might be a useful therapeutic target of NSCLC.
20153295 This data suggests that the phosphorylation of Yap at Ser127 leads to a changed expression of myogenic regulatory factors and cell cycle regulators and is required for C2C12 myoblasts to differentiate into myotubes.
20048001 identified CK1delta/epsilon as new regulators of YAP and uncovered an intricate mechanism of YAP regulation
20016275 Results strongly suggest that Yap1 plays a role in the regulation of endogenous DeltaNp63alpha levels and is likely to contribute to the regulation of DeltaNp63alpha, in physiological conditions.
19952108 findings implicate YAP1 as a new Shh effector that may be targeted by medulloblastoma therapies aimed at eliminating medulloblastoma recurrence.
19935651 show that YAP-expressing MCF10A breast epithelial cells enhance the proliferation of neighbouring untransfected cells, implicating a non-cell-autonomous mechanism.
19705503 Yes-associated protein and survivin have roles in gastric carcinoma and precancerous lesions
19371381 The PDZ-binding motif is necessary for YAP2 localization in the nucleus, for the stabilization of p73, and for promoting apoptosis of HEK293 cells maintained at low concentration of serum.
19111660 The existence of a proapoptotic autoregulatory feedback loop between p73, YAP, and the promyelocytic leukemia (PML) tumor suppressor gene, is shown.
19015275 YAP and TEAD gain of function causes marked expansion of the neural progenitor population, partly owing to their ability to promote cell cycle progression by inducing cyclin D1 and to inhibit differentiation by suppressing NeuroM.
18953429 results represent the first demonstration that merlin regulates cell growth in meningioma cells by suppressing YAP
18725387 this is the first report of negative regulatory signaling from Merlin to YAP1 in mammalian cells and may shed light on mechanisms of malignant pleural mesothelioma development
18703216 findings suggest that activation of the Hippo signaling pathway may occur through YAP as part of cell proliferation in normal tissue homeostasis and also might be a frequently activated oncogenic pathway in 3 common malignant tumor types.
18701449 The modified Yap1 does not co-activate Runx in supporting Itch transcription. The subsequent reduction in the Itch level gives rise to p73 accumulation.
18640976 Overexpression of YAP2 in cells promoted apoptosis, whereas the Mst2/Lats1-induced phosphorylation of YAP partially rescued the cells from apoptotic death.
18617895 This is the first report indicating YAP as a tumor suppressor, revealing its decreased expression in breast cancer as well as demonstrating the functional implications of YAP loss in several aspects of cancer signaling.
18413746 Expression profiling of genes induced by ectopic expression of YAP or by knockdown of LATS1 reveals a subset of the potential Drosophila Hippo pathway targets implicated in epithelial-to-mesenchymal transition.
18280240 c-Abl directly phosphorylates Yap1 at position Y357 in response to DNA damage. Tyrosine-phosphorylated Yap1 is a more stable protein that displays higher affinity to p73 and selectively coactivates p73 proapoptotic target genes.
18175224 Increased YAP protein is associated with esophageal and gastric epithelial tumorigenesis.
18158288 LATS1 inactivates YAP oncogenic function by suppressing its transcription regulation of cellular genes via sequestration of YAP in the cytoplasm after phosphorylation of YAP.
17980593 findings report that YAP1 increases organ size and causes aberrant tissue expansion
17889654 Delineate a mammalian Hippo signaling pathway that culminates in the phosphorylation of YAP, the mammalian homolog of Yki. Is a potent regulator of organ size, and its dysregulation leads to tumorigenesis.
17823615 YAP identified as a novel and critical downstream effector of c-Jun-mediated apoptosis following cisplatin treatment
17502622 Proline-rich Gla protein 2 may be involved in a signal transduction pathway, the impairment of which may be an unintended consequence of warfarin therapy
17438369 the RUNX2 and YAP65 interaction has a novel role in oncogenic transformation that may be mediated by modulation of p21(CIP1) protein expression
17110958 The Yes-associated protein 1 stabilizes p73 by preventing Itch-mediated ubiquitination of p73.
16894141 Results point to a potential oncogenic role for YAP in 11q22-amplified human cancers, and suggest that this signaling pathway regulates both cellular proliferation and apoptosis in mammalian epithelial cells.
16772533 WBP-2 and YAP are coactivators for estrogen and progesterone receptor transactivation pathways.
16596258 Results suggested that YAP65 plays a role in the normal and diseased pancreas.
16061658 WWOX antagonizes the function of YAP by competing for interaction with ErbB-4 and other targets and thus affect its transcriptional activity.
15800888 the minimum binding domain is larger than the latter two strands of the WW domain beta-sheet
15096513 Yap binds to HNRNPU and regulates its co-activation of Bax transcription
12807903 YAP is a potential signaling partner of the full-length ErbB4 receptor at the membrane and of the COOH-terminal fragment of ErbB-4 that translocates to the nucleus to regulate transcription
11743730 NMR structures of the YAP65 WW domain and the variant L30 K in complex with the peptides GTPPPPYTVG, N-(n-octyl)-GPPPY and PLPPY and the application of peptide libraries reveal a minimal binding epitope

AA Sequence

MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFN      1 - 70
AVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPG     71 - 140
TLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQM    141 - 210
NVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVK    211 - 280
QPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRS    281 - 350
QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV    351 - 420
DEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVL    421 - 490
AATKLDKESFLTWL                                                            491 - 504
//

Text Mined References (357)

PMID Year Title
26986510 2016 Cdc42 deficiency induces podocyte apoptosis by inhibiting the Nwasp/stress fibers/YAP pathway.
26967905 2016 Novel NEK8 Mutations Cause Severe Syndromic Renal Cystic Dysplasia through YAP Dysregulation.
26944315 2016 Nuclear accumulation of Yes-Associated Protein (YAP) maintains the survival of doxorubicin-induced senescent cells by promoting survivin expression.
26923924 2016 Neurofibromatosis 2 (NF2) controls the invasiveness of glioblastoma through YAP-dependent expression of CYR61/CCN1 and miR-296-3p.
26876920 2016 ZEB1 turns into a transcriptional activator by interacting with YAP1 in aggressive cancer types.
26791271 2016 Yes-associated protein (YAP) signaling regulates lipopolysaccharide-induced tissue factor expression in human endothelial cells.
26759237 2016 RASSF1A Suppresses the Invasion and Metastatic Potential of Human Non-Small Cell Lung Cancer Cells by Inhibiting YAP Activation through the GEF-H1/RhoB Pathway.
26691213 2016 YAP enhances the pro-proliferative transcriptional activity of mutant p53 proteins.
26678338 2015 A MYC-Driven Change in Mitochondrial Dynamics Limits YAP/TAZ Function in Mammary Epithelial Cells and Breast Cancer.
26671411 2015 A basal-like breast cancer-specific role for SRF-IL6 in YAP-induced cancer stemness.
26668310 2016 Identification of an Endogenously Generated Cryptic Collagen Epitope (XL313) That May Selectively Regulate Angiogenesis by an Integrin Yes-associated Protein (YAP) Mechano-transduction Pathway.
26668268 2016 Actin remodeling confers BRAF inhibitor resistance to melanoma cells through YAP/TAZ activation.
26634820 2015 SerpinB3 and Yap Interplay Increases Myc Oncogenic Activity.
26617849 2015 Expression of Yes-associated protein (YAP) in metastatic breast cancer.
26611634 2015 The Hippo pathway effectors YAP and TAZ promote cell growth by modulating amino acid signaling to mTORC1.
26598551 2016 Role of Angiomotin-like 2 mono-ubiquitination on YAP inhibition.
26575609 2016 Fat4 suppression induces Yap translocation accounting for the promoted proliferation and migration of gastric cancer cells.
26574480 2016 Involvement of the Hippo pathway in regeneration and fibrogenesis after ischaemic acute kidney injury: YAP is the key effector.
26572166 2016 YAP overexpression promotes the epithelial-mesenchymal transition and chemoresistance in pancreatic cancer cells.
26567630 2015 Role of YAP and TAZ in pancreatic ductal adenocarcinoma and in stellate cells associated with cancer and chronic pancreatitis.
26549256 2015 Alternate RASSF1 Transcripts Control SRC Activity, E-Cadherin Contacts, and YAP-Mediated Invasion.
26459764 2016 Myocardin-Related Transcription Factor A and Yes-Associated Protein Exert Dual Control in G Protein-Coupled Receptor- and RhoA-Mediated Transcriptional Regulation and Cell Proliferation.
26458763 2015 YAP1 Is a Driver of Myofibroblast Differentiation in Normal and Diseased Fibroblasts.
26439301 2015 YAP Drives Growth by Controlling Transcriptional Pause Release from Dynamic Enhancers.
26432639 2015 TAZ Protein Accumulation Is Negatively Regulated by YAP Abundance in Mammalian Cells.
26426694 2015 Decreased Yes-Associated Protein-1 (YAP1) Expression in Pediatric Hearts with Ventricular Septal Defects.
26420216 2015 An Imbalance in TAZ and YAP Expression in Hepatocellular Carcinoma Confers Cancer Stem Cell-like Behaviors Contributing to Disease Progression.
26417066 2015 The Hippo/YAP pathway interacts with EGFR signaling and HPV oncoproteins to regulate cervical cancer progression.
26359368 2015 NF2 Loss Promotes Oncogenic RAS-Induced Thyroid Cancers via YAP-Dependent Transactivation of RAS Proteins and Sensitizes Them to MEK Inhibition.
26327812 2015 Proton-sensing GPCR-YAP Signalling Promotes Cell Proliferation and Survival.
26316081 2015 MiR-497 Suppresses YAP1 and Inhibits Tumor Growth in Non-Small Cell Lung Cancer.
26315483 2015 YAP activates the Hippo pathway in a negative feedback loop.
26299613 2015 FOXM1 is a downstream target of LPA and YAP oncogenic signaling pathways in high grade serous ovarian cancer.
26295846 2015 YAP1 Exerts Its Transcriptional Control via TEAD-Mediated Activation of Enhancers.
26276632 2015 Alternative Wnt Signaling Activates YAP/TAZ.
26272168 2015 A miR-130a-YAP positive feedback loop promotes organ size and tumorigenesis.
26263504 2015 Prognostic Value of Yes-Associated Protein 1 (YAP1) in Various Cancers: A Meta-Analysis.
26254048 2016 Yes-associated protein (YAP) expression is involved in epithelial-mesenchymal transition in hepatocellular carcinoma.
26243870 2015 Yap and Taz are required for Ret-dependent urinary tract morphogenesis.
26239136 2015 miR-138 suppresses the proliferation of oral squamous cell carcinoma cells by targeting Yes-associated protein 1.
26173433 2015 YAP promotes proliferation, chemoresistance, and angiogenesis in human cholangiocarcinoma through TEAD transcription factors.
26169195 2015 Roles of YAP in mediating endothelial cell junctional stability and vascular remodeling.
26163939 2015 The YAP1 oncogene contributes to bladder cancer cell proliferation and migration by regulating the H19 long noncoding RNA.
26136233 2015 The Hippo transducers TAZ and YAP in breast cancer: oncogenic activities and clinical implications.
26126522 2015 YAP is closely correlated with castration-resistant prostate cancer, and downregulation of YAP reduces proliferation and induces apoptosis of PC-3 cells.
26124339 2015 Altered Expression of Yes-associated Protein and ?-Catenin in Non-neoplastic and Neoplastic Gastric Surface Epithelia.
26119935 2016 YAP activation protects urothelial cell carcinoma from treatment-induced DNA damage.
26096363 2015 Hsa-miR-132 inhibits proliferation of hepatic carcinoma cells by targeting YAP.
26058078 2015 ERG Activates the YAP1 Transcriptional Program and Induces the Development of Age-Related Prostate Tumors.
26056182 2015 R331W Missense Mutation of Oncogene YAP1 Is a Germline Risk Allele for Lung Adenocarcinoma With Medical Actionability.
26039999 2015 Netrin-1 exerts oncogenic activities through enhancing Yes-associated protein stability.
26025096 2015 Yes-associated protein (YAP) is a negative regulator of chondrogenesis in mesenchymal stem cells.
26015398 2015 YAP is a critical oncogene in human cholangiocarcinoma.
25998128 2015 Phosphorylation of the Hippo Pathway Component AMOTL2 by the mTORC2 Kinase Promotes YAP Signaling, Resulting in Enhanced Glioblastoma Growth and Invasiveness.
25973055 2015 LATS2-mediated YAP1 phosphorylation is involved in HCC tumorigenesis.
25971581 2015 Promyelocytic leukemia protein enhances apoptosis of gastric cancer cells through Yes-associated protein.
25962877 2015 Yes-associated protein regulates endothelial cell contact-mediated expression of angiopoietin-2.
25955651 2015 Mutant GNAQ promotes cell viability and migration of uveal melanoma cells through the activation of Notch signaling.
25936800 2015 SMADs and YAP compete to control elongation of ?-catenin:LEF-1-recruited RNAPII during hESC differentiation.
25915126 2015 TEAD and YAP regulate the enhancer network of human embryonic pancreatic progenitors.
25908270 2015 The Hippo pathway effector YAP controls mouse hepatic stellate cell activation.
25895125 2015 A novel role for microRNA-129-5p in inhibiting ovarian cancer cell proliferation and survival via direct suppression of transcriptional co-activators YAP and TAZ.
25849865 2015 Actin remodelling factors control ciliogenesis by regulating YAP/TAZ activity and vesicle trafficking.
25846731 2015 MicroRNA-506 inhibits gastric cancer proliferation and invasion by directly targeting Yap1.
25846049 2015 The Hippo pathway transcriptional co-activator, YAP, confers resistance to cisplatin in human oral squamous cell carcinoma.
25843714 2015 Transcriptional co-repressor function of the hippo pathway transducers YAP and TAZ.
25811979 2015 YAP enhances autophagic flux to promote breast cancer cell survival in response to nutrient deprivation.
25794680 2015 A YAP/TAZ-Regulated Molecular Signature Is Associated with Oral Squamous Cell Carcinoma.
25778702 2015 YAP is essential for tissue tension to ensure vertebrate 3D body shape.
25772246 2015 Cell growth density modulates cancer cell vascular invasion via Hippo pathway activity and CXCR2 signaling.
25754111 2015 YAP1 Regulates OCT4 Activity and SOX2 Expression to Facilitate Self-Renewal and Vascular Mimicry of Stem-Like Cells.
25751140 2015 Cellular energy stress induces AMPK-mediated regulation of YAP and the Hippo pathway.
25750037 2015 Role of Yes-associated protein 1 in gliomas: pathologic and therapeutic aspects.
25743273 2015 Targeting of YAP1 by microRNA-15a and microRNA-16-1 exerts tumor suppressor function in gastric adenocarcinoma.
25739674 2015 The Hippo Coactivator YAP1 Mediates EGFR Overexpression and Confers Chemoresistance in Esophageal Cancer.
25727017 2015 A hairpin within YAP mRNA 3'UTR functions in regulation at post-transcription level.
25691658 2015 YAP regulates the expression of Hoxa1 and Hoxc13 in mouse and human oral and skin epithelial tissues.
25670079 2015 14-3-3? turns TGF-?'s function from tumor suppressor to metastasis promoter in breast cancer by contextual changes of Smad partners from p53 to Gli2.
25658431 2015 Sub-cellular localisation studies may spuriously detect the Yes-associated protein, YAP, in nucleoli leading to potentially invalid conclusions of its function.
25652178 2015 YAP/TAZ for cancer therapy: opportunities and challenges (review).
25645929 2015 The hippo pathway effector YAP regulates motility, invasion, and castration-resistant growth of prostate cancer cells.
25636199 2015 YAP-mediated induction of monoacylglycerol lipase restrains oncogenic transformation.
25635998 2015 YAP regulates S-phase entry in endothelial cells.
25628125 2015 Genetic variants in Hippo pathway genes YAP1, TEAD1 and TEAD4 are associated with melanoma-specific survival.
25625370 2015 Knockdown of yes-associated protein inhibits proliferation and downregulates large tumor suppressor 1 expression in MHCC97H human hepatocellular carcinoma cells.
25607725 2015 Yes-associated protein regulates the growth of human non-small cell lung cancer in response to matrix stiffness.
25607641 2015 WW domains of the yes-kinase-associated-protein (YAP) transcriptional regulator behave as independent units with different binding preferences for PPxY motif-containing ligands.
25605730 2015 Oncoprotein YAP regulates the spindle checkpoint activation in a mitotic phosphorylation-dependent manner through up-regulation of BubR1.
25605020 2015 Adhesion glycoprotein CD44 functions as an upstream regulator of a network connecting ERK, AKT and Hippo-YAP pathways in cancer progression.
25592648 2015 The emerging roles of YAP and TAZ in cancer.
25516090 2015 YAP immunoreactivity is directly related to pilomatrixoma size and proliferation rate.
25502501 2015 Mechanosignaling through YAP and TAZ drives fibroblast activation and fibrosis.
25492965 2014 Neuregulin 1-activated ERBB4 interacts with YAP to induce Hippo pathway target genes and promote cell migration.
25492964 2014 Neuregulin 1-activated ERBB4 as a "dedicated" receptor for the Hippo-YAP pathway.
25473897 2015 FGF8 promotes colorectal cancer growth and metastasis by activating YAP1.
25438054 2015 Hypoxia regulates Hippo signalling through the SIAH2 ubiquitin E3 ligase.
25436413 2015 The E3 ubiquitin ligase Itch and Yap1 have antagonistic roles in the regulation of ASPP2 protein stability.
25433207 2015 Nf2-Yap signaling controls the expansion of DRG progenitors and glia during DRG development.
25425573 2014 Arhgef7 promotes activation of the Hippo pathway core kinase Lats.
25404446 2014 Prognostic role of SIRT1 in hepatocellular carcinoma.
25393475 2014 The Hippo pathway is controlled by Angiotensin II signaling and its reactivation induces apoptosis in podocytes.
25388162 2015 Significant association of oncogene YAP1 with poor prognosis and cetuximab resistance in colorectal cancer patients.
25384421 2015 Targeting Hippo pathway by specific interruption of YAP-TEAD interaction using cyclic YAP-like peptides.
25360797 2014 ASPP2 links the apical lateral polarity complex to the regulation of YAP activity in epithelial cells.
25344213 2015 Metaplastic carcinoma show different expression pattern of YAP compared to triple-negative breast cancer.
25337244 2014 Expression of Yes-associated protein (YAP) in breast phyllodes tumor.
25304677 2014 Expression of Yes-associated protein in cervical squamous epithelium lesions.
25290150 2014 Involvement of YAP, TAZ and HSP90 in contact guidance and intercellular junction formation in corneal epithelial cells.
25288394 2014 Regulation of YAP by mTOR and autophagy reveals a therapeutic target of tuberous sclerosis complex.
25283809 2014 Ligand binding to WW tandem domains of YAP2 transcriptional regulator is under negative cooperativity.
25270913 2014 Methylation?associated inactivation of LATS1 and its effect on demethylation or overexpression on YAP and cell biological function in human renal cell carcinoma.
25261601 2014 Tumor suppressor long non-coding RNA, MT1DP is negatively regulated by YAP and Runx2 to inhibit FoxA1 in liver cancer cells.
25218593 2014 Yes-associated protein 1 (YAP1) promotes human gallbladder tumor growth via activation of the AXL/MAPK pathway.
25201954 2014 Substratum-induced differentiation of human pluripotent stem cells reveals the coactivator YAP is a potent regulator of neuronal specification.
25180228 2014 Opposing activities of the Ras and Hippo pathways converge on regulation of YAP protein turnover.
25175178 2014 YAP is overexpressed in clear cell renal cell carcinoma and its knockdown reduces cell proliferation and induces cell cycle arrest and apoptosis.
25168380 2014 The alteration of Hippo/YAP signaling in the development of hypertrophic cardiomyopathy.
25127217 2014 Regulation of YAP by mechanical strain through Jnk and Hippo signaling.
25122798 2014 Polyomavirus small T antigen interacts with yes-associated protein to regulate cell survival and differentiation.
25115923 2014 YAP inhibits squamous transdifferentiation of Lkb1-deficient lung adenocarcinoma through ZEB2-dependent DNp63 repression.
25101858 2014 CD44 acts through RhoA to regulate YAP signaling.
25087998 2014 MiR-506 suppresses proliferation of hepatoma cells through targeting YAP mRNA 3'UTR.
25087979 2014 The Hippo transducer YAP1 transforms activated satellite cells and is a potent effector of embryonal rhabdomyosarcoma formation.
25078107 2014 Hypoxic conditions differentially regulate TAZ and YAP in cancer cells.
25031743 2014 Yes-associated protein (YAP) is differentially expressed in tumor and stroma according to the molecular subtype of breast cancer.
24993351 2014 Knockdown of YAP1 inhibits the proliferation of osteosarcoma cells in vitro and in vivo.
24976009 2014 YAP/TAZ incorporation in the ?-catenin destruction complex orchestrates the Wnt response.
24972085 2014 Yes-associated protein (YAP) modulates oncogenic features and radiation sensitivity in endometrial cancer.
24954536 2014 KRAS and YAP1 converge to regulate EMT and tumor survival.
24906622 2014 Hippo coactivator YAP1 upregulates SOX9 and endows esophageal cancer cells with stem-like properties.
24884509 2014 Fbxw7 is an independent prognostic marker and induces apoptosis and growth arrest by regulating YAP abundance in hepatocellular carcinoma.
24882516 2014 Mutant Gq/11 promote uveal melanoma tumorigenesis by activating YAP.
24881775 2014 Harnessing Hippo in the heart: Hippo/Yap signaling and applications to heart regeneration and rejuvenation.
24860833 2014 Expression and clinical significance of YAP, TAZ, and AREG in hepatocellular carcinoma.
24837480 2014 Activation of ?-catenin and Yap1 in human hepatoblastoma and induction of hepatocarcinogenesis in mice.
24833660 2014 Cardiac-specific YAP activation improves cardiac function and survival in an experimental murine MI model.
24813251 2014 Rescue of Hippo coactivator YAP1 triggers DNA damage-induced apoptosis in hematological cancers.
24810989 2014 YAP1 acts as oncogenic target of 11q22 amplification in multiple cancer subtypes.
24810048 2014 Chaetocin-induced ROS-mediated apoptosis involves ATM-YAP1 axis and JNK-dependent inhibition of glucose metabolism.
24806962 2014 Cellular microenvironments reveal defective mechanosensing responses and elevated YAP signaling in LMNA-mutated muscle precursors.
24803537 2014 Downstream of mutant KRAS, the transcription regulator YAP is essential for neoplastic progression to pancreatic ductal adenocarcinoma.
24779718 2014 microRNA 31 functions as an endometrial cancer oncogene by suppressing Hippo tumor suppressor pathway.
24728461 2014 Hippo/YAP-mediated rigidity-dependent motor neuron differentiation of human pluripotent stem cells.
24726915 2014 ANKHD1, a novel component of the Hippo signaling pathway, promotes YAP1 activation and cell cycle progression in prostate cancer cells.
24703331 2014 In melanoma, Hippo signaling is affected by copy number alterations and YAP1 overexpression impairs patient survival.
24682895 2014 Expression of LATS1 contributes to good prognosis and can negatively regulate YAP oncoprotein in non-small-cell lung cancer.
24648515 2014 The transcriptional regulators TAZ and YAP direct transforming growth factor ?-induced tumorigenic phenotypes in breast cancer cells.
24643316 2014 Overexpression of YAP1 is correlated with progression, metastasis and poor prognosis in patients with gastric carcinoma.
24622501 2014 YAP promotes ovarian cancer cell tumorigenesis and is indicative of a poor prognosis for ovarian cancer patients.
24621512 2014 Nicotine activates YAP1 through nAChRs mediated signaling in esophageal squamous cell cancer (ESCC).
24606817 2014 YAP expression in normal and neoplastic breast tissue: an immunohistochemical study.
24581491 2014 Hippo signaling regulates microprocessor and links cell-density-dependent miRNA biogenesis to cancer.
24559095 2014 Decreased expression of Yes-associated protein is associated with outcome in the luminal A breast cancer subgroup and with an impaired tamoxifen response.
24558021 2014 Proteomic screening identifies a YAP-driven signaling network linked to tumor cell proliferation in human schwannomas.
24525233 2014 A peptide mimicking VGLL4 function acts as a YAP antagonist therapy against gastric cancer.
24511017 2014 Activation of YAP1 is associated with poor prognosis and response to taxanes in ovarian cancer.
24482231 2014 Cluster of differentiation 166 (CD166) regulated by phosphatidylinositide 3-Kinase (PI3K)/AKT signaling to exert its anti-apoptotic role via yes-associated protein (YAP) in liver cancer.
24468535 2014 Mutual inhibition between YAP and SRSF1 maintains long non-coding RNA, Malat1-induced tumourigenesis in liver cancer.
24462371 2014 Heterozygous loss-of-function mutations in YAP1 cause both isolated and syndromic optic fissure closure defects.
24389730 2014 YAP regulates cell proliferation, migration, and steroidogenesis in adult granulosa cell tumors.
24380865 2014 The PDZ-binding motif of Yes-associated protein is required for its co-activation of TEAD-mediated CTGF transcription and oncogenic cell transforming activity.
24369055 2013 E2A suppresses invasion and migration by targeting YAP in colorectal cancer cells.
24367099 2014 Interplay of mevalonate and Hippo pathways regulates RHAMM transcription via YAP to modulate breast cancer cell motility.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24362629 2014 A genetic screen identifies an LKB1-MARK signalling axis controlling the Hippo-YAP pathway.
24346160 2014 The dual functions of YAP-1 to promote and inhibit cell growth in human malignancy.
24324261 2014 The Hippo pathway effectors TAZ/YAP regulate dicer expression and microRNA biogenesis through Let-7.
24323901 2014 Colon cancer cells escape 5FU chemotherapy-induced cell death by entering stemness and quiescence associated with the c-Yes/YAP axis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24268772 2013 Bile acids activate YAP to promote liver carcinogenesis.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24242138 2014 Prognostic significance of microRNA-141 expression and its tumor suppressor function in human pancreatic ductal adenocarcinoma.
24223879 2013 A functional variant rs1820453 in YAP1 and breast cancer risk in Chinese population.
24211253 2013 MEK1 promotes YAP and their interaction is critical for tumorigenesis in liver cancer.
24115727 2014 Aberrant activation, nuclear localization, and phosphorylation of Yes-associated protein-1 in the embryonic kidney and Wilms tumor.
24106282 2013 Cross-ethnic meta-analysis of genetic variants for polycystic ovary syndrome.
24101513 2013 Serum deprivation inhibits the transcriptional co-activator YAP and cell growth via phosphorylation of the 130-kDa isoform of Angiomotin by the LATS1/2 protein kinases.
24101467 2013 Menin promotes hepatocellular carcinogenesis and epigenetically up-regulates Yap1 transcription.
24101154 2013 CDK1 phosphorylation of YAP promotes mitotic defects and cell motility and is essential for neoplastic transformation.
24086533 2013 Increased expression of Yes-associated protein 1 in hepatocellular carcinoma with stemness and combined hepatocellular-cholangiocarcinoma.
24023255 2013 Ajuba family proteins link JNK to Hippo signaling.
24003254 2013 The p130 isoform of angiomotin is required for Yap-mediated hepatic epithelial cell proliferation and tumorigenesis.
24003252 2013 Angiomotin'g YAP into the nucleus for cell proliferation and cancer development.
23994632 2013 Mutual interaction between YAP and c-Myc is critical for carcinogenesis in liver cancer.
23994529 2013 Interaction with the Yes-associated protein (YAP) allows TEAD1 to positively regulate NAIP expression.
23949920 2013 Nuclear localization of the transcriptional coactivator YAP is associated with invasive lobular breast cancer.
23897276 2014 Pro-invasive activity of the Hippo pathway effectors YAP and TAZ in cutaneous melanoma.
23870412 2013 Overexpression of YAP 1 contributes to progressive features and poor prognosis of human urothelial carcinoma of the bladder.
23762387 2013 Overexpression of YAP and TAZ is an independent predictor of prognosis in colorectal cancer and related to the proliferation and metastasis of colon cancer cells.
23760493 2013 Yes-associated protein (YAP) increases chemosensitivity of hepatocellular carcinoma cells by modulation of p53.
23737213 2013 Novel YAP1-TFE3 fusion defines a distinct subset of epithelioid hemangioendothelioma.
23727052 2013 Substratum stiffness and latrunculin B modulate the gene expression of the mechanotransducers YAP and TAZ in human trabecular meshwork cells.
23685355 2013 Overexpression of miR-10a and miR-375 and downregulation of YAP1 in medullary thyroid carcinoma.
23673988 2013 Differential expression of Yes-associated protein and phosphorylated Yes-associated protein is correlated with expression of Ki-67 and phospho-ERK in colorectal adenocarcinoma.
23667252 2013 Yes-associated protein (YAP) promotes cell survival by inhibiting proapoptotic dendrin signaling.
23613971 2013 The tyrosine phosphatase PTPN14 is a negative regulator of YAP activity.
23594797 2013 RASSF1A-mediated regulation of AREG via the Hippo pathway in hepatocellular carcinoma.
23576552 2013 YAP/TEAD-mediated transcription controls cellular senescence.
23564455 2013 Amot130 adapts atrophin-1 interacting protein 4 to inhibit yes-associated protein signaling and cell growth.
23558963 2013 Clinical and prognostic significance of Yes-associated protein in colorectal cancer.
23544078 2013 Constitutive expression of Yes-associated protein (Yap) in adult skeletal muscle fibres induces muscle atrophy and myopathy.
23542177 2014 SIRT1 regulates YAP2-mediated cell proliferation and chemoresistance in hepatocellular carcinoma.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23532963 2013 Mutual interaction between YAP and CREB promotes tumorigenesis in liver cancer.
23527718 The role and clinical significance of YES-associated protein 1 in human osteosarcoma.
23502453 2013 Clinical significance of yes-associated protein overexpression in cervical carcinoma: the differential effects based on histotypes.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
23422184 2013 Expression of Yes-associated protein 1 gene and protein in oral squamous cell carcinoma.
23340296 2013 MicroRNA-200a promotes anoikis resistance and metastasis by targeting YAP1 in human breast cancer.
23333315 2013 Mask proteins are cofactors of Yorkie/YAP in the Hippo pathway.
23333314 2013 Mask is required for the activity of the Hippo pathway effector Yki/YAP.
23298489 YES-associated protein 1 promotes adenocarcinoma growth and metastasis through activation of the receptor tyrosine kinase Axl.
23298488 Clinicopathologic characteristics of YES-associated protein 1 overexpression and its relationship to tumor biomarkers in gastric cancer.
23245941 2012 ?-Catenin-driven cancers require a YAP1 transcriptional complex for survival and tumorigenesis.
23232767 2013 Overexpression of Yes-associated protein confers doxorubicin resistance in hepatocellullar carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178811 2013 Restriction of intestinal stem cell expansion and the regenerative response by YAP.
23160371 2013 YAP1 oncogene and its eight isoforms.
23158133 2012 Expression of Yes-associated protein in non-small cell lung cancer and its relationship with clinical pathological factors.
23060277 2013 Knockdown of GPC3 inhibits the proliferation of Huh7 hepatocellular carcinoma cells through down-regulation of YAP.
23058008 Expression of Yes-associated protein in gastric adenocarcinoma and inhibitory effects of its knockdown on gastric cancer cell proliferation and metastasis.
23027379 2013 Intersection of Hippo/YAP and Wnt/?-catenin signaling pathways.
23027127 2013 LKB1 tumor suppressor regulates AMP kinase/mTOR-independent cell growth and proliferation via the phosphorylation of Yap.
22993325 2012 Nuclear expression of Yes-associated protein 1 correlates with poor prognosis in intestinal type gastric cancer.
22948661 2012 PTPN14 is required for the density-dependent control of YAP1.
22939869 2012 Identification, basic characterization and evolutionary analysis of differentially spliced mRNA isoforms of human YAP1 gene.
22895435 2012 Transduction of mechanical and cytoskeletal cues by YAP and TAZ.
22885925 2012 Genome-wide association study identifies eight new risk loci for polycystic ovary syndrome.
22863277 2012 Regulation of the Hippo-YAP pathway by G-protein-coupled receptor signaling.
22843909 2012 Yes-associated protein is not an independent prognostic marker in breast cancer.
22707013 2012 Hepatitis B virus X protein modulates oncogene Yes-associated protein by CREB to promote growth of hepatoma cells.
22689061 2013 YAP modifies cancer cell sensitivity to EGFR and survivin inhibitors and is negatively regulated by the non-receptor type protein tyrosine phosphatase 14.
22632819 2012 YAP promotes breast cell proliferation and survival partially through stabilizing the KLF5 transcription factor.
22618028 2012 Yes-associated protein 1 is activated and functions as an oncogene in meningiomas.
22609549 2012 Insulin/IGF signaling drives cell proliferation in part via Yorkie/YAP.
22558212 2012 YAP1 recruits c-Abl to protect angiomotin-like 1 from Nedd4-mediated degradation.
22544757 2012 A novel acetylation cycle of transcription co-activator Yes-associated protein that is downstream of Hippo pathway is triggered in response to SN2 alkylating agents.
22525271 2013 PTPN14 interacts with and negatively regulates the oncogenic function of YAP.
22499345 2012 Identification of YAP1 as a novel susceptibility gene for polycystic ovary syndrome.
22436626 2012 Expression of Yes-associated protein modulates Survivin expression in primary liver malignancies.
22396793 2012 Down-regulation of Yes Associated Protein 1 expression reduces cell proliferation and clonogenicity of pancreatic cancer cells.
22337891 2012 Wnt/?-catenin signaling regulates Yes-associated protein (YAP) gene expression in colorectal carcinoma cells.
22308035 2012 Identification of mechanism that couples multisite phosphorylation of Yes-associated protein (YAP) with transcriptional coactivation and regulation of apoptosis.
22286761 2012 YAP induces malignant mesothelioma cell proliferation by upregulating transcription of cell cycle-promoting genes.
22234184 2012 A molecular mechanism that links Hippo signalling to the inhibition of Wnt/?-catenin signalling.
22098159 2012 Deregulation of Hippo kinase signalling in human hepatic malignancies.
22096589 2011 Yes-associated protein expression in head and neck squamous cell carcinoma nodal metastasis.
22056638 2012 Yes-associated protein promotes tumour development in luminal epithelial derived breast cancer.
22042863 2011 Mst1 and Mst2 protein kinases restrain intestinal stem cell proliferation and colonic tumorigenesis by inhibition of Yes-associated protein (Yap) overabundance.
22024089 RNA interference mediated YAP gene silencing inhibits invasion and metastasis of human gastric cancer cell line SGC-7901.
22012126 2012 Differences in Yes-associated protein and mRNA levels in regenerating liver and hepatocellular carcinoma.
21981024 2011 Biophysical analysis of binding of WW domains of the YAP2 transcriptional regulator to PPXY motifs within WBP1 and WBP2 adaptors.
21909427 2011 PP1A-mediated dephosphorylation positively regulates YAP2 activity.
21874045 2012 Oncogenic YAP promotes radioresistance and genomic instability in medulloblastoma through IGF2-mediated Akt activation.
21856745 2011 miR-375 is activated by ASH1 and inhibits YAP1 in a lineage-dependent manner in lung cancer.
21800344 2011 Connective tissue growth factor autocriny in human hepatocellular carcinoma: oncogenic role and regulation by epidermal growth factor receptor/yes-associated protein-mediated activation.
21708480 2011 Yes-associated protein promotes cell proliferation by activating Fos Related Activator-1 in oral squamous cell carcinoma.
21685940 2012 Opposing roles of angiomotin-like-1 and zona occludens-2 on pro-apoptotic function of YAP.
21666501 2011 Yes-associated protein 1 is widely expressed in human brain tumors and promotes glioblastoma growth.
21654799 2011 Role of YAP/TAZ in mechanotransduction.
21610251 2011 ?-catenin is a tumor suppressor that controls cell accumulation by regulating the localization and activity of the transcriptional coactivator Yap1.
21454516 2011 The human adenocarcinoma-associated gene, AGR2, induces expression of amphiregulin through Hippo pathway co-activator YAP1 activation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399893 2012 Loss of Yes-associated protein (YAP) expression is associated with estrogen and progesterone receptors negativity in invasive breast carcinomas.
21376238 2011 Yap1 acts downstream of ?-catenin to control epidermal proliferation.
21364637 2010 JNK phosphorylates Yes-associated protein (YAP) to regulate apoptosis.
21346147 2011 Yes-associated protein 1 exhibits oncogenic property in gastric cancer and its nuclear accumulation associates with poor prognosis.
21317925 2011 The Hippo pathway transcriptional co-activator, YAP, is an ovarian cancer oncogene.
21269460 2011 Initial characterization of the human central proteome.
21224387 2011 Hippo pathway-independent restriction of TAZ and YAP by angiomotin.
21205866 2011 Angiomotin is a novel Hippo pathway component that inhibits YAP oncoprotein.
21187284 2011 Angiomotin-like proteins associate with and negatively regulate YAP1.
21170084 2011 BMI-1 suppresses contact inhibition and stabilizes YAP in Ewing sarcoma.
21118971 2010 Genome-wide interrogation identifies YAP1 variants associated with survival of small-cell lung cancer patients.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
21112960 2011 YAP is a candidate oncogene for esophageal squamous cell carcinoma.
21076472 2011 AXL receptor kinase is a mediator of YAP-dependent oncogenic functions in hepatocellular carcinoma.
21041411 2010 Cytoplasmic ASPP1 inhibits apoptosis through the control of YAP.
20951342 2010 The hippo signaling pathway in development and cancer.
20947521 2010 Hippo pathway effector Yap is an ovarian cancer oncogene.
20868367 2010 Functional complexes between YAP2 and ZO-2 are PDZ domain-dependent, and regulate YAP2 nuclear localization and signalling.
20842732 2010 YAP1 and VGLL3, encoding two cofactors of TEAD transcription factors, are amplified and overexpressed in a subset of soft tissue sarcomas.
20823509 2010 Structure of a 14-3-3?-YAP phosphopeptide complex at 1.15 A resolution.
20729916 2010 YAP dysregulation by phosphorylation or ?Np63-mediated gene repression promotes proliferation, survival and migration in head and neck cancer subsets.
20677011 2010 Overexpression of YAP1 induces immortalization of normal human keratinocytes by blocking clonal evolution.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20226166 2010 MicroRNA-375 targets Hippo-signaling effector YAP in liver cancer and inhibits tumor properties.
20219076 2010 Overexpression of yes-associated protein contributes to progression and poor prognosis of non-small-cell lung cancer.
20153295 2010 Yap is a novel regulator of C2C12 myogenesis.
20123908 2010 Structural basis of YAP recognition by TEAD4 in the hippo pathway.
20123905 2010 Structural insights into the YAP and TEAD complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20048001 2010 A coordinated phosphorylation by Lats and CK1 regulates YAP stability through SCF(beta-TRCP).
20016275 2010 Yes-associated protein 1 regulates the stability of DeltaNp63alpha.
19952108 2009 YAP1 is amplified and up-regulated in hedgehog-associated medulloblastomas and mediates Sonic hedgehog-driven neural precursor proliferation.
19935651 2009 YAP-dependent induction of amphiregulin identifies a non-cell-autonomous component of the Hippo pathway.
19914168 2009 Nuclear CDKs drive Smad transcriptional activation and turnover in BMP and TGF-beta pathways.
19705503 2009 Significance and relationship between Yes-associated protein and survivin expression in gastric carcinoma and precancerous lesions.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19371381 2009 Nuclear localization and pro-apoptotic signaling of YAP2 require intact PDZ-binding motif.
19111660 2008 PML, YAP, and p73 are components of a proapoptotic autoregulatory feedback loop.
19015275 2008 YAP regulates neural progenitor cell number via the TEA domain transcription factor.
18953429 2008 The neurofibromatosis 2 tumor suppressor gene product, merlin, regulates human meningioma cell growth by signaling through YAP.
18725387 2008 YAP1 is involved in mesothelioma development and negatively regulated by Merlin through phosphorylation.
18703216 2008 Expression of Yes-associated protein in common solid tumors.
18701449 2008 A regulatory circuit controlling Itch-mediated p73 degradation by Runx.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18640976 2008 Mst2 and Lats kinases regulate apoptotic function of Yes kinase-associated protein (YAP).
18617895 2008 Yes-associated protein (YAP) functions as a tumor suppressor in breast.
18579750 2008 TEAD mediates YAP-dependent gene induction and growth control.
18413746 2008 Negative regulation of YAP by LATS1 underscores evolutionary conservation of the Drosophila Hippo pathway.
18280240 2008 Yap1 phosphorylation by c-Abl is a critical step in selective activation of proapoptotic genes in response to DNA damage.
18175224 2006 The hippo pathway in human upper gastrointestinal dysplasia and carcinoma: a novel oncogenic pathway.
18158288 2008 Tumor suppressor LATS1 is a negative regulator of oncogene YAP.
17980593 2007 YAP1 increases organ size and expands undifferentiated progenitor cells.
17974916 2007 Inactivation of YAP oncoprotein by the Hippo pathway is involved in cell contact inhibition and tissue growth control.
17889654 2007 Elucidation of a universal size-control mechanism in Drosophila and mammals.
17823615 2008 Yes-associated protein (YAP) is a critical mediator of c-Jun-dependent apoptosis.
17535448 2007 Regulation of p73 by Hck through kinase-dependent and independent mechanisms.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17502622 2007 Proline-rich Gla protein 2 is a cell-surface vitamin K-dependent protein that binds to the transcriptional coactivator Yes-associated protein.
17438369 2007 The RUNX2 transcription factor cooperates with the YES-associated protein, YAP65, to promote cell transformation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17110958 2007 The Yes-associated protein 1 stabilizes p73 by preventing Itch-mediated ubiquitination of p73.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16894141 2006 Transforming properties of YAP, a candidate oncogene on the chromosome 11q22 amplicon.
16772533 2006 WW domain binding protein-2, an E6-associated protein interacting protein, acts as a coactivator of estrogen and progesterone receptors.
16596258 2006 Yes-associated protein (YAP65) in relation to Smad7 expression in human pancreatic ductal adenocarcinoma.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16461361 2006 Transcriptional repression induces a slowly progressive atypical neuronal death associated with changes of YAP isoforms and p73.
16166090 2005 NHERF2/SIP-1 interacts with mouse SRY via a different mechanism than human SRY.
16061658 2005 WW domain-containing proteins, WWOX and YAP, compete for interaction with ErbB-4 and modulate its transcriptional function.
15800888 2005 An autonomously folding beta-hairpin derived from the human YAP65 WW domain: attempts to define a minimum ligand-binding motif.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
15096513 2004 Heterogeneous nuclear ribonuclear protein U associates with YAP and regulates its co-activation of Bax transcription.
15023535 2004 Ligand-regulated association of ErbB-4 to the transcriptional co-activator YAP65 controls transcription at the nuclear level.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12807903 2003 WW domain-containing protein YAP associates with ErbB-4 and acts as a co-transcriptional activator for the carboxyl-terminal fragment of ErbB-4 that translocates to the nucleus.
12535517 2003 Akt phosphorylates the Yes-associated protein, YAP, to induce interaction with 14-3-3 and attenuation of p73-mediated apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12118366 2002 Yes-associated protein (YAP65) interacts with Smad7 and potentiates its inhibitory activity against TGF-beta/Smad signaling.
11743730 2001 Solution structures of the YAP65 WW domain and the variant L30 K in complex with the peptides GTPPPPYTVG, N-(n-octyl)-GPPPY and PLPPY and the application of peptide libraries reveal a minimal binding epitope.
11687614 2001 Using flexible loop mimetics to extend phi-value analysis to secondary structure interactions.
11358867 2001 TEAD/TEF transcription factors utilize the activation domain of YAP65, a Src/Yes-associated protein localized in the cytoplasm.
11278685 2001 Physical interaction with Yes-associated protein enhances p73 transcriptional activity.
11278422 2001 Yes-associated protein and p53-binding protein-2 interact through their WW and SH3 domains.
10562288 1999 Yes-associated protein 65 localizes p62(c-Yes) to the apical compartment of airway epithelia by association with EBP50.
10228168 1999 A WW domain-containing yes-associated protein (YAP) is a novel transcriptional co-activator.
9305852 1997 Interaction of WW domains with hematopoietic transcription factor p45/NF-E2 and RNA polymerase II.
9202023 1997 Characterization of the WW domain of human yes-associated protein and its polyproline-containing ligands.
7782338 1995 Characterization of the mammalian YAP (Yes-associated protein) gene and its role in defining a novel protein module, the WW domain.
7644498 1995 The WW domain of Yes-associated protein binds a proline-rich ligand that differs from the consensus established for Src homology 3-binding modules.