Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.54
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -2.000 1.4e-03
group 3 medulloblastoma 1.500 4.6e-05
hepatocellular carcinoma 1.100 3.7e-05

AA Sequence

MSWVQAASLIQGPGDKGDVFDEEADESLLAQREWQSNMQRRVKEGYRDGIDAGKAVTLQQGFNQGYKKGA      1 - 70
EVILNYGRLRGTLSALLSWCHLHNNNSTLINKINNLLDAVGQCEEYVLKHLKSITPPSHVVDLLDSIEDM     71 - 140
DLCHVVPAEKKIDEAKDERLCENNAEFNKNCSKSHSGIDCSYVECCRTQEHAHSENPSPTWILEQTASLV    141 - 210
KQLGLSVDVLQHLKQL                                                          211 - 226
//

Text Mined References (10)

PMID Year Title