Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.54
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
hepatocellular carcinoma 1.100 3.7e-05
group 3 medulloblastoma 1.500 4.6e-05
acute myeloid leukemia -2.000 1.4e-03

Synonym

Accession Q9NRH1 A4D1W4 B4DE83 Q6IAF7 Q8WVZ5
Symbols GK003
C7orf36

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSWVQAASLIQGPGDKGDVFDEEADESLLAQREWQSNMQRRVKEGYRDGIDAGKAVTLQQGFNQGYKKGA      1 - 70
EVILNYGRLRGTLSALLSWCHLHNNNSTLINKINNLLDAVGQCEEYVLKHLKSITPPSHVVDLLDSIEDM     71 - 140
DLCHVVPAEKKIDEAKDERLCENNAEFNKNCSKSHSGIDCSYVECCRTQEHAHSENPSPTWILEQTASLV    141 - 210
KQLGLSVDVLQHLKQL                                                          211 - 226
//

Text Mined References (10)

PMID Year Title
26182403 2015 The deca-GX3 proteins Yae1-Lto1 function as adaptors recruiting the ABC protein Rli1 for iron-sulfur cluster insertion.
16341674 2005 Transcriptome analysis of human gastric cancer.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.