Property Summary

NCBI Gene PubMed Count 39
PubMed Score 31.33
PubTator Score 30.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma 1.500 1.1e-07
glioblastoma 1.300 4.0e-05
osteosarcoma 2.100 2.4e-06
sonic hedgehog group medulloblastoma 2.200 2.2e-05
atypical teratoid/rhabdoid tumor 1.600 4.2e-05
medulloblastoma, large-cell 2.300 1.1e-05
primitive neuroectodermal tumor 1.500 1.5e-06
intraductal papillary-mucinous carcinoma... -1.100 4.4e-04
diabetes mellitus -1.200 2.8e-03
pediatric high grade glioma 1.400 8.8e-04
ovarian cancer -1.700 2.1e-06

Gene RIF (19)

PMID Text
26728557 P-TEFb regulates termination by promoting chromatin recruitment and activation of a cotranscriptional RNA processing enzyme, Xrn2.
26531822 The results suggest that CARF regulates early steps of pre-rRNA processing during ribosome biogenesis by controlling spatial distribution of XRN2 between the nucleoplasm and nucleolus.
26474067 Kinetic competition between elongating pol II and the Xrn2 exonuclease is integral to termination of transcription on most human genes.
26340924 Chromatin immunoprecipitation experiments further show that IL-1 stimulation leads to decrease in NKRF aa 421-429 phosphorylation and dissociation of NELF-E and XRN2 by concomitant resumption of transcription elongation of a synthetic reporter
26159921 found that the 3' fragments of target pre-mRNA generated by ASO were almost completely degraded from their 5' ends by nuclear XRN2 after RNase H1-mediated cleavage
25673723 The restriction of JFH1 and H77D hepatitis C virus replication by Xrn2 is likely indirect in nature and possibly linked to cytopathic effects of these robustly replicating viruses.
25128458 Mammalian target of rapamycin protein regulates the diffusion of Xrn2 from the nucleolus to the nucleoplasm under heat stress conditions.
25121753 Xrn2 has a cytoplasmic, antiviral function against HCV that is counteracted by HCV's subversion of miR-122 to form a protective oligomeric complex at the 5' end of the viral genome.
25010285 Interaction of HIV-1 Gag with 5'-3' exoribonuclease 2 (XRN2) is identified in a series of six affinity purification/mass spectrometry screens
23857582 hnRNPK may play a role in recruitment of XRN2 to gene loci thus regulating coupling 3'-end pre-mRNA processing to transcription termination.
22980978 Microprocessor orchestrates the recruitment of termination factors Setx and Xrn2, and the 3'-5' exoribonuclease, Rrp6, to initiate RNAPII pausing and premature termination at the HIV-1 promoter through cleavage of the stem-loop RNA, TAR.
22522706 Xrn2 associated with and co-transcriptionally degraded nascent beta-globin transcripts. Evidence was provided that many endogenous pre-mRNAs are also co-transcriptionally degraded by Xrn2 when their processing is inhibited by Spliceostatin A.
22483619 Xrn2 has a role in control of transcription by RNA polymerase II.
21700224 The results predict that senataxin is required for the resolution of R-loops formed downstream of the poly(A) signal, allowing Xrn2 recruitment and efficient Pol II transcriptional termination.
19915612 Genetic variants regulating Xrn2 expression in cis are determinants of spontaneous lung tumor susceptibility in mice and have genetic equivalents in lung cancer susceptibility in human beings.
18955505 Degradation of the downstream cleavage product (DCP) does not depend on the Xrn2 5' exonuclease, suggesting that CPSF-73 degrades the DCP both in vitro and in vivo.
17639083 p54 is present along the length of genes, and small interfering RNA (siRNA)-mediated knockdown leads to defects in XRN2 recruitment and termination.
16147866 XRN2b is mainly expressed in blood leukocyte tissue, while XRN2a is detected in several human tissues and in human tumor tissues
15565158 co-transcriptional cleavage acts as a precursor to termination by presenting a free RNA 5' end that is recognized by the human 5' --> 3' exonuclease Xrn2

AA Sequence

MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDASKPNPNDVEFDNLYLDMNGIIHPCTHPEDKPA      1 - 70
PKNEDEMMVAIFEYIDRLFSIVRPRRLLYMAIDGVAPRAKMNQQRSRRFRASKEGMEAAVEKQRVREEIL     71 - 140
AKGGFLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIADRLNNDPGWKNLTVILSDASAPGEGEHKIMD    141 - 210
YIRRQRAQPNHDPNTHHCLCGADADLIMLGLATHEPNFTIIREEFKPNKPKPCGLCNQFGHEVKDCEGLP    211 - 280
REKKGKHDELADSLPCAEGEFIFLRLNVLREYLERELTMASLPFTFDVERSIDDWVFMCFFVGNDFLPHL    281 - 350
PSLEIRENAIDRLVNIYKNVVHKTGGYLTESGYVNLQRVQMIMLAVGEVEDSIFKKRKDDEDSFRRRQKE    351 - 420
KRKRMKRDQPAFTPSGILTPHALGSRNSPGSQVASNPRQAAYEMRMQNNSSPSISPNTSFTSDGSPSPLG    421 - 490
GIKRKAEDSDSEPEPEDNVRLWEAGWKQRYYKNKFDVDAADEKFRRKVVQSYVEGLCWVLRYYYQGCASW    491 - 560
KWYYPFHYAPFASDFEGIADMPSDFEKGTKPFKPLEQLMGVFPAASGNFLPPSWRKLMSDPDSSIIDFYP    561 - 630
EDFAIDLNGKKYAWQGVALLPFVDERRLRAALEEVYPDLTPEETRRNSLGGDVLFVGKHHPLHDFILELY    631 - 700
QTGSTEPVEVPPELCHGIQGKFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDPQFAEDYIFKAVM    701 - 770
LPGARKPAAVLKPSDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVMPRGSGTGIYSNAAPPPVT    771 - 840
YQGNLYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQQRFDRGVGAEPLLPWNRMLQTQNAAFQPNQYQ    841 - 910
MLAGPGGYPPRRDDRGGRQGYPREGRKYPLPPPSGRYNWN                                  911 - 950
//

Text Mined References (54)

PMID Year Title
26779609 2016 Structural basis and function of XRN2 binding by XTB domains.
26728557 2016 P-TEFb regulation of transcription termination factor Xrn2 revealed by a chemical genetic screen for Cdk9 substrates.
26700805 2016 SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination.
26531822 2015 Collaborator of alternative reading frame protein (CARF) regulates early processing of pre-ribosomal RNA by retaining XRN2 (5'-3' exoribonuclease) in the nucleoplasm.
26474067 2015 Effects of Transcription Elongation Rate and Xrn2 Exonuclease Activity on RNA Polymerase II Termination Suggest Widespread Kinetic Competition.
26340924 2016 NF-?B-repressing factor phosphorylation regulates transcription elongation via its interactions with 5'?3' exoribonuclease 2 and negative elongation factor.
26159921 2015 XRN2 is required for the degradation of target RNAs by RNase H1-dependent antisense oligonucleotides.
25673723 2015 Dissecting the roles of the 5' exoribonucleases Xrn1 and Xrn2 in restricting hepatitis C virus replication.
25128458 2014 mTOR regulates the nucleoplasmic diffusion of Xrn2 under conditions of heat stress.
25121753 2014 Hepatitis C virus subverts liver-specific miR-122 to protect the viral genome from exoribonuclease Xrn2.
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
24462208 2014 PAXT-1 promotes XRN2 activity by stabilizing it through a conserved domain.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23857582 2013 Heterogeneous nuclear ribonucleoprotein (HnRNP) K genome-wide binding survey reveals its role in regulating 3'-end RNA processing and transcription termination at the early growth response 1 (EGR1) gene through XRN2 exonuclease.
23482395 2013 Gradual processing of the ITS1 from the nucleolus to the cytoplasm during synthesis of the human 18S rRNA.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22980978 2012 Microprocessor, Setx, Xrn2, and Rrp6 co-operate to induce premature termination of transcription by RNAPII.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22522706 2012 Co-transcriptional degradation of aberrant pre-mRNA by Xrn2.
22483619 2012 mRNA decapping factors and the exonuclease Xrn2 function in widespread premature termination of RNA polymerase II transcription.
21700224 2011 Human senataxin resolves RNA/DNA hybrids formed at transcriptional pause sites to promote Xrn2-dependent termination.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19915612 2010 Genetic variants cis-regulating Xrn2 expression contribute to the risk of spontaneous lung tumor.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18955505 2009 Studies of the 5' exonuclease and endonuclease activities of CPSF-73 in histone pre-mRNA processing.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17639083 2007 The multifunctional protein p54nrb/PSF recruits the exonuclease XRN2 to facilitate pre-mRNA 3' processing and transcription termination.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16648491 2006 Pause sites promote transcriptional termination of mammalian RNA polymerase II.
16147866 2005 A novel splice variant of human XRN2 gene is mainly expressed in blood leukocyte.
15635413 2005 Nucleolar proteome dynamics.
15565158 2004 Human 5' --> 3' exonuclease Xrn2 promotes transcription termination at co-transcriptional cleavage sites.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14527413 2003 Nonsense-mediated mRNA decay in mammalian cells involves decapping, deadenylating, and exonucleolytic activities.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10409438 1999 Cloning and mapping of the XRN2 gene to human chromosome 20p11.1-p11.2.