Property Summary

NCBI Gene PubMed Count 261
PubMed Score 665.64
PubTator Score 302.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (2)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.248 2.1e-03
ovarian cancer 1.700 2.3e-04

Gene RIF (174)

PMID Text
26976509 Ku is intact and retains DNA binding activity in early apoptotic cells.
26772202 Results show that under hypoxia, Ku70 and DNA-PKcs interact with nuclear RON which activates non-homologous end joining DNA repair conferring chemoresistance.
26754263 We believe that for the first time, genetic variants at XRCC6 and MVP genes are associated with risk of more aggressive disease, and would be taken into account when assessing the malignancy of prostate cancer
26712563 Our results demonstrate that the phosphorylation-mediated dissociation of Ku70/80 from DSBs frees DNA ends, allowing the initiation of HR in S phase and providing a mechanism of DSB repair pathway choice in mammalian cells.
26360636 HIV-1 MA interacts with XRCC6 (Ku70)
26359349 Data suggest that heat shock factor 1 (HSF1) interacts with both Ku autoantigens Ku70 and Ku86 to induce defective non-homologous end joining (NHEJ) repair activity and genomic instability.
26337656 these data unveil an involvement of phospho-Ku70 in fast but inaccurate DNA repair; a new paradigm linked to both the deregulation of canonical nonhomologous end-joining and the resistance of malignant cells
26149939 XRCC6 may play an important role in the carcinogenesis of NPC and could serve as a chemotherapeutic target for personalized medicine and therapy.
26055322 A direct interaction between Ku70/86 and BRG1 brings together SWI/SNF remodeling capabilities and TOP2beta activity to enhance the transcriptional response to hormone stimulation.
25818292 retinoblastoma tumor suppressor protein variants disabled for the interaction with XRCC5 and XRCC6, including a cancer-associated variant, are unable to support canonical non-homologous end-joining despite being able to confer cell-cycle control
25756210 Polymorphism in XRCC6 gene is associated with Systemic Lupus Erythematosus.
25702660 Both the CG carriers/G allele carriers of rs2267437 (XRCC6) and the haplotype AT/CC established by the SNPs of XRCC5 are associated with ESCC (Esophageal Squamous Cell Carcinoma) susceptibility.
25695595 the results of the present study suggested that Ku70 acetylation mediated TSA-induced apoptosis in CRC cells. In addition, Ku70 was found to be indispensable in TSA-induced apoptosis due to its role in protecting Bax from proteosomal degradation.
25569644 single nucleotide polymorphisms in promoter region might play different roles in various cancers [review]
25496916 HIV-1 MA interacts with XRCC6 (Ku70)
25299772 SMAR1-mediated regulation of repair and apoptosis via a complex crosstalk involving Ku70, HDAC6 and Bax.
25046228 loss of expression correlates with decreased survival in gall bladder malignancies patients
25000480 EEF1A1, SSRP1, and XRCC6 are novel interacting partners of the mineralocorticoid receptor
24942867 RECQL4 stimulates higher order DNA binding of Ku70/Ku80 to a blunt end DNA substrate. Taken together, these results implicate that RECQL4 participates in the NHEJ pathway of DSB repair via a functional interaction with the Ku70/Ku80 complex.
24769731 Ku70 is a novel Mcl-1 deubiquitinase that could be a potential target for cancer therapy by manipulating Mcl-1 deubiquitination.
24615008 the VNTR polymorphism at the promoter region of XRCC5, but not XRCC6, may have a role in breast cancer risk or age at diagnosis of breast cancer
24382701 A single nucleotide polymorphism that tags both the XRCC6 and SREBF2 genes strongly modifies the association between bladder cancer risk and smoking
24324074 findings suggest that the XRCC6 genotype could serve as a predictor of childhood leukemia risk and XRCC6 could serve as a target for personalized medicine and therapy
24305947 SET/TAF-Ibeta interacts with Ku70/80 in the nucleus and inhibits Ku70 acetylation.
24187467 Enhanced DNA-PKcs and Ku 70/80 expression may be closely associated with gastric carcinoma.
23863879 HIV-1 MA interacts with XRCC6 (Ku70)
23745766 This meta-analysis suggests that the XRCC6 rs2267437 polymorphism may affect breast cancer susceptibility and increase the risk of cancer in Asian populations and in the general population.
23677788 Processivity factor 8 (PF-8) of Kaposi's sarcoma-associated herpesvirus was identified as interacting with Ku70 and Ku86, and the interaction was dependent on DNA double-strand breaks and DNA.
23650516 An interaction of RECQ1 with Ku70/80 and a role of the human RecQ helicase in double-strand break repair through nonhomologous end-joining.
23624778 KU70/KU80 may play a role in DNA DSBs repair in HR-deficient tumours. Further study of other NHEJ markers in sporadic BC is warranted.
23620595 Data indicate that Ku70/Ku80 facilitate the cooperative binding of multiple XRCC4/Ligase IV (XL) and XLF molecules to DNA.
23457464 This model highlights the importance of Ku70/80 oxidation which leads to increased Ku70/80 dissociation rates from DNA damage foci and shifts repair in favour of the less efficient Back-up-Non-Homologous End Joining system.
23393345 Our findings suggested that XRCC6 may play an important role in Hepatocellular carcinoma carcinogenesis in the Taiwanese population.
23349316 Because the Ku70 protein is essential for the NHEJ repair of DSBs and its downregulation impairs DNA repair, this offers a possible explanation for the increased radiosensitivity of prostate cancer cells following castration
23322783 Results show the N-terminal region mediates the interaction between DNA-PKcs and the Ku70/Ku80-DNA complex and is required for its DNA double-stranded breaks (DSBs)-induced enzymatic activity.
23271361 XRCC6 C1310G polymorphism is associated with risk of cancer development.
23247197 SIRT1 inhibition increases Ku70 acetylation, and the acetylated Ku70 with a decreased function mediates the induction of DR5 and the down-regulation of c-FLIP by up-regulating c-Myc/ATF4/CHOP pathway,promotes the TRAIL-induced apoptosis
23154512 Down-regulated Ku70 expression was associated with chromosomal instability in colorectal cancer.
23098447 XRCC gene polymorphism is associated with breast cancer.
22993329 The XRCC6 T-991C genotype together with its mRNA expression are involved in the etiology of RCC and may be a marker for susceptibility to RCC in the population of Taiwan.
22745744 caveolin-1 acts as an anti-apoptotic protein in colon cancer cells by binding to Ku70 and inhibiting Bax-dependent cell death.
22617044 Hypoxia-induced cell lethality was facilitated by DNKu70, but substantially repaired upon reoxygenation.
22593040 the Ku70 C-1310G polymorphism is involved in the etiology of the renal cell carcinoma in Chinese populations
22535209 Data indicate that dynamic remodeling of the Ku complex coincided with exit of Ku and other DNA repair proteins from the nucleolus.
22524845 Ku70-1310C/G promoter polymorphism is associated with cancer
22455395 Ku70 A-31G polymorphism is involved in the etiology of RCC
22442688 DEAF1 can interact with the DNA-PK complex through interactions of its DNA binding domain with the carboxy-terminal region of Ku70 that contains the Bax binding domain, and that DEAF1 is a potential substrate for DNA-PK.
22399625 XRCC6 promoter T-991C, but not the promoter C-57G, promoter G-31A or intron 3, is associated with lung cancer susceptibility
22226402 Data indicate a significant positive association was found between female patients with anti-Ku p70 and joint/bone features, and a significant negative association was found between female patients with anti-Ku p80 only and joint/bone features.
22179609 Human Ku70/80 protein blocks exonuclease 1-mediated DNA resection in the presence of human Mre11 or Mre11/Rad50 protein complex.
22037767 The mutagenesis of Ku70 vWA domain S155/D156 unexpectedly increased cell survival following ionizing radiation (IR) treatment.
21972126 Report XRCC6 impacts age-related decline in telomere length but is not associated with longevity.
21756904 The function of KARP-1 could not perfectly replace that of Ku80 in DSB repair, although KARP-1 has some biochemical properties, which resemble those of Ku80, and also works as a heterodimer with Ku70. KARP-1 may have a novel role in DSB response.
21671178 Radiosensitivity in the glioblastoma cell line U251 induced by sodium butyrate involves an inhibited expression of Ku70 and an increase in gamma-H2AX foci.
21575261 the Ku70 promoter T-991C (rs5751129) is associated with gastric cancer susceptibility.
21556760 Ku70 -1310C/G promoter polymorphism may be a susceptibility factor for breast cancer in Chinese Han population.
21521024 the studies investigating the association between the XRCC5/XRCC6 dimer and the susceptibility to multiple cancers and discuss its role in carcinogenesis and its potential application to anticancer drug discovery were summarized.
21512205 Data show that shRNA-mediated knockdown of the Ku70/80 heterodimer inhibits ALT cell growth and results in a significant decrease in the levels of t-circles without affecting overall telomere length.
21454661 HIV-1 MA interacts with XRCC6 (Ku70)
21423092 Ku70 expression in poorly-differentiated tumors is significantly higher than in well and moderately-differentiated colorectal tumors.
21398614 Data show that Ku70 mediates type III IFN induction by DNA.
21349273 Data show that the heterodimeric domain of Ku was sufficient for the recruitment of XLF to DSBs and for the interaction of Ku with XLF.
21304054 single nucleotide polymorphisms in XRCC5 and XRCC6 may play a role in determination of individual susceptibility profile to hepatocellular carcinoma.
21256093 the mechanism by which PARP-1 is promoting mutagenic repair is by inhibiting high-fidelity repair which would otherwise be mediated by Ku70 and Lig4
21116096 characterized a radiosensitive phenotype due to reduced levels of the Ku70 and Ku80 DNA repair proteins
21108727 Both Ku and SIRT1 are induced during restoration of fibroblast replicative senscence and are required for senescent cells to return to a youthful phenotype.
21107697 Distinct differences in the repair process following doxorubicin versus etoposide were seen in concentration dependency, time-course and requirement of Ku70 and Rad51 proteins.
21070772 coilin interacts with Ku70 and Ku80
21042724 Different roles of DNA-PKcs and Ku70/80 in repair and cell death regulation after DNA damage.
20718578 Some fungal, but no bacterial or viral, proteins have statistically significant amino acid sequence homology with the p70 or p80 subunit of Ku and might trigger the onset of anti-Ku autoimmunity via molecular mimicry.
20697560 acetylation and functional regulation of Ku70, which coordinately regulates DNA repair and cell death, in neuroblastoma
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20610542 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20570964 a conserved critical Ku70 role for FOXO function toward coordination of a survival program
20538911 study found genetic interaction between Fanconi anemia(FA)gene FANCC and Ku70; results indicate FA pathway promotes homologous recombination repair of DNA double-strand breaks (DSBs) by counteracting Ku70; suggest this achieved by modification of DSBs
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496270 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20493174 these findings suggest that the 55K CDK9 protein may function in repair of DNA through an association with Ku70.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20383123 Ku can be identified as an effective 5'-dRP/AP lyase; data support an unexpected direct role for Ku in end-processing steps
20368362 Data show that XPC and Ku oppositely regulate the ubiquitin ligase activity of DDB2, and that DDB2 complex-mediated ubiquitylation plays a role in recruiting XPA to damaged sites
20127252 The expression of Ku70 antigen may work to reduce the telomere length in precancerous lesions and offer new insight into the mechanism of carcinogenesis in gastric cancer.
20047046 Ku80 is susceptible to proteolytic degradation when not dimerized with Ku70; dimer induces DNA-PK activity; evidence that interacting domain(s) of Xenopus DNA-PKcs is conserved so as to interact with human Ku, reconstituting a functional holoenzyme
19913121 Observational study of gene-disease association. (HuGE Navigator)
19906305 Ku70 and Ku80 proteins in interaction with AP-2 (alpha and gamma) contribute to increased ERBB2 mRNA and protein levels in breast cancer cells.
19809793 Ku70/80 is a potential target for immunotherapy of glioblastoma multiforme.
19794960 Data show that DSB promote PP2A to associate with Ku 70 and Ku 86.
19750561 HIV-1 MA interacts with XRCC6 (Ku70)
19692349 Ku70 is a regulator of Bax-mediated pathogenesis in laminin-alpha2-deficiency muscle cells.
19672258 cervical carcinoma surviving radiotherapy have an increased DNA-PK expression: residual tumours showed increased frequency of DNA-PKcs (P=0.037), Ku70 (P=0.018), Ku86 (P=0.008) positive cells
19467273 It appears that the HCV-core protein facilitates the degradation of Ku70 and reduces DNA-PK activity in noncancerous liver cells.
19408343 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19265193 p53 acetylation liberates BAX from Ku70
19251090 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19219618 the variant allele of c.-1310 C>G, located in the Ku70 promoter, is a risk allele for breast cancer; the association of the c.-1310 C>G SNP with breast cancer risk was stronger in women with a long oestrogen exposure
19219618 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19181665 NRF-1 can also directly interact with poly(ADP-ribose) polymerase 1 (PARP-1) and co-purify the PARP-1.DNA-PK.Ku80.Ku70.topoisomerase IIbeta-containing protein complex.
19177010 Data suggest that Ku70-Bax-clusterin interactions in human colon cancer are modulated by IL-6 that influences Bax-dependent cell death increasing Ku70 binding to Bax and influencing sCLU production that promotes tumor cell survival.
19134120 Rickettsia conorii OmpB mediates bacterial epithelial cell invasion through Ku70 in an actin, c-Cbl, clathrin and caveolin 2-dependent manner.
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18990028 Observational study of gene-disease association. (HuGE Navigator)
18809223 ApoC-IV overexpression may perturb lipid metabolism leading to lipid accumulation. HCV core protein may modulate ApoC-IV expression through Ku antigen and PPARgamma/RXRalpha complex.
18768166 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18757043 Ku antigen as a part of DNA-PK was shown to inhibit abasic site cleavage by apurinic/apyrimidinic endonuclease 1.
18706726 Hypoxia downregulates Ku70/80 expression in cervical carcinoma tumors.
18546291 Ku70 mRNA was the marker most significantly associated with response to induction chemotherapy (IC). Moreover, high tumor Ku70 mRNA expression was associated with significantly longer local recurrence-free survival (LRFS).
18487076 results showed that there were significant differences between the oral cancer and control groups in the distribution of their genotypes (P=0.0031) and allelic frequency (P=0.0009) in the Ku70 promoter T-991C polymorphism.
18487076 Observational study of gene-disease association. (HuGE Navigator)
18374504 Observational study of gene-disease association. (HuGE Navigator)
18362350 Ku70 regulates apoptosis by sequestering Bax from the mitochondria and mediating Bax deubiquitylation
18303113 point mutation observed by transcriptome sequencing of malignant pleural mesothelioma tumors
18208821 Autoantibodies against Ku are elicited by macromolecular protein complexes containing Ku and the associated DNA damage proteins may be involved of autoimmunity in rheumatic diseases.
18164703 Ku80 is essential for Ku70 accumulation at DSBs. Three domains of Ku80, i.e., the N-terminal alpha/beta, the DNA-binding, and Ku70-binding domains, seem to necessary for the accumulation at or recognition of DSBs in the early stage after irradiation
18000863 Observational study of gene-disease association. (HuGE Navigator)
17982634 Expression of Ku70 in breast cancer tissue and normal breast tissue with immunohistochemistry are largely equal.
17971348 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17952468 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17885668 These results indicate that Bax and Ku70 acetylation play important roles in Q79C-induced cell death, and that BIP may be useful in the development of therapeutics for polyQ diseases.
17768380 Observational study of gene-disease association. (HuGE Navigator)
17768380 The Ku70 promoter T-991C, but not the Ku70 promoter C-57G polymorphism, is correlated with pterygium.
17714764 Genes encoding KU70, MGST1 and BIK show age-related mRNA expression levels in hematopoietic stem cells.
17671430 potential relevance of Bin1-Ku interaction to cancer are discussed in light of these findings
17617666 TrkA signaling appears to be proapoptotic in the absence of Ku70.
17496833 These data support a new role for Ku in the migration of monocytes into tissues, which depends on a tightly regulated pathway of intracellular redistribution.
17479409 Ku70 protein plays an important role in repair of DNA DSB (double-strand breaks) damage and for maintainance of genome stability.
17389609 Observational study of gene-disease association. (HuGE Navigator)
17334224 SIRT1 modulates DNA repair activity, which could be regulated by the acetylation status of repair protein Ku70 following DNA damage
17304248 HIV-1 MA interacts with XRCC6 (Ku70)
17202845 maintenance of higher expression of Ku70 and Mre11 may be responsible for keeping longer life span observed in the longevity group
17187679 poly(ADP-ribose)polymerase-1 and Ku70/Ku80 are transcriptional regulators of S100A9 gene expression
17159921 The three-dimensional structure of the human full-length Ku70-Ku80 dimer at 25 A resolution, alone and in complex with DNA, by using single-particle electron microscopy was reconstructed.
17124166 Functions in nonhomologous DNA end joining.
16857680 Ku-mediated assembly of DNA-PK on DNA ends is responsible for a dissociation of the DNA-PKcs.Artemis complex.
16713581 Dimeric particles are observed in which two DNA-PKcs/Ku70/Ku80 holoenzymes interact through the N-terminal HEAT repeats.
16448389 The present study suggests that Ku binds IRES -(internal ribosomal entry site)elements within RNA molecules, and that Ku plays a role in the modulation of IRES- mediated mRNA translation.
16440001 Ku70 has other antiapoptotic functions in Granzyme A (GzmA)-induced cell death, which are blocked when GzmA proteolyses Ku70
16360032 Ku70 is a receptor for the rickettsial protein rOmpB. Bacterial internalization is dependent on the presence of cholesterol-enriched microdomains containing Ku70.
15958648 Observational study of gene-disease association. (HuGE Navigator)
15905197 The level of Ku70 in the cytoplasm was decreased, but that of Bax in mitochondria was increased by justicidin A in colorectal cancer cells.
15827325 Ku70 has a role in human cancer cell sensitization to radiation and etoposide treatments
15824061 Ku70/80 interacts directly with the RNA component of human telomerase, independent of the human telomerase reverse transcriptase protein.
15613478 Histone gamma-H2AX promotes binding of nuclear DNA helicase II to transcriptionally stalled sites on chromosomal DNA.
15220460 DNA-binding component of human OF-1 (which binds Herpes simplex virus type 1 origin of replication) contains Ku70 and Ku80 proteins
15123719 Results show that Ku70/Ku80 and DNA-dependent protein kinase catalytic subunit (DNA-PKcs) modulate RAG-mediated cleavage during V(D)J recombination.
15075319 activity of ESE-1 is positively and negatively modulated by other interacting proteins including Ku70, Ku86, p300, and CBP.
15019772 cell-surface Ku functions as an adhesion receptor for fibronectin; both Ku70 and Ku80 present a structural relationship with integrin I (or A) domains and the A1 and A3 domains of von Willebrand factor, domains known to be involved in Fn binding
14991539 Expression of both genes was down-regulated as melanoma progressed. In situ hybridization demonstrated more Ku70- and Ku80-positive cells than immunohistochemical methods, but the correlation between the two methods was highly significant (P <0.01).
14734561 (ADP-ribosyl)ation of Ku70/80 reduces the ability of this factor to stimulate WRN exonuclease, suggesting that covalent modification of Ku70/80 by PARP-1 may play a role in the regulation of the exonucleolytic activity of WRN.
14627815 DNA-PK can be activated by nucleosomes through the ability of Ku to bind to the ends of nucleosomal DNA, and that the activated DNA-PK is capable of phosphorylating H2AX within the nucleosomes
14570916 Ku antigen interacts with RBP-Jkappa and NF-kappaB p50 may act as a positive regulator of p50 expression in gastric cancer AGS cells.
12867423 DNA repair proteins Ku70 and Ku80 expression is lost in cell nucleus after oxidative stress
12750264 Observational study of gene-disease association. (HuGE Navigator)
12664629 This autoantigen is induced by a divergence in intracellular signaling between IL-4 and IL-13.
12664628 This antigen acts as the transcription factor induced by interleukins (IL)-13 and -4 leading to induction of 15-lipoxygenase (15-LO) in human cells.
12547193 Coordinated assembly of Ku and p460 subunits of the DNA-dependent protein kinase on DNA ends is necessary for XRCC4-ligase IV recruitment
12518983 The mechanism that regulates for nuclear localization of Ku70 and Ku80 appears to play, at least in part, a key role in regulating the physiological function of Ku in vivo.
12494870 In naevus cell naevi, significant correlations were found between Ku70/80 gene expression and some ploidy-related parameters.
12467650 Transcripts of Ku70 and Ku86 genes were detected by RT-PCR and Ku protein was localized in the nucleus of neutrophils as a heterodimer
12377759 Ku associates with hTERT, and this interaction may function to regulate the access of telomerase to telomeric DNA ends
12368356 HIV-1 MA interacts with XRCC6 (Ku70)
12324457 role of expression in NF-kappaB activation and COX-2 expression
12177300 Ku heterodimer binds to both ends of the Werner protein and functional interaction occurs at the Werner N-terminus
12145306 regulates osteocalcin gene expression
11821378 binding with inositol hexakisphosphate
11796732 Studies on the mode of Ku interaction with DNA
11406603 HIV-1 MA interacts with XRCC6 (Ku70)
11158303 HIV-1 MA interacts with XRCC6 (Ku70)
11070027 HIV-1 MA interacts with XRCC6 (Ku70)
10213687 HIV-1 MA interacts with XRCC6 (Ku70)
8240370 HIV-1 MA interacts with XRCC6 (Ku70)

AA Sequence

MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSV      1 - 70
YISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSD     71 - 140
YSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGG    141 - 210
FDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKA    211 - 280
LKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGF    281 - 350
KPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEEL    351 - 420
DDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNL    421 - 490
EALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYS    491 - 560
EEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD                         561 - 609
//

Text Mined References (275)

PMID Year Title
26976509 2016 DNA binding activity of Ku during chemotherapeutic agent-induced early apoptosis.
26772202 2016 RON Nuclear Translocation under Hypoxia Potentiates Chemoresistance to DNA Double-Strand Break-Inducing Anticancer Drugs.
26754263 2016 Association between single-nucleotide polymorphisms in DNA double-strand break repair genes and prostate cancer aggressiveness in the Spanish population.
26712563 2016 Phosphorylation of Ku dictates DNA double-strand break (DSB) repair pathway choice in S phase.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26359349 2015 Heat shock factor 1, an inhibitor of non-homologous end joining repair.
26337656 2015 A new phosphorylated form of Ku70 identified in resistant leukemic cells confers fast but unfaithful DNA repair in cancer cell lines.
26149939 2015 The role of XRCC6/Ku70 in nasopharyngeal carcinoma.
26055322 2015 Glucocorticoid Receptor Transcriptional Activation via the BRG1-Dependent Recruitment of TOP2? and Ku70/86.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25941166 2015 XLS (c9orf142) is a new component of mammalian DNA double-stranded break repair.
25852083 2015 DNA-dependent protein kinase (DNA-PK) permits vascular smooth muscle cell proliferation through phosphorylation of the orphan nuclear receptor NOR1.
25818292 2015 Direct involvement of retinoblastoma family proteins in DNA repair by non-homologous end-joining.
25756210 2015 Association Between Functional Polymorphisms of DNA Double-Strand Breaks in Repair Genes XRCC5, XRCC6 and XRCC7 with the Risk of Systemic Lupus Erythematosus in South East Iran.
25702660 Association of the genetic polymorphisms in XRCC6 and XRCC5 with the risk of ESCC in a high-incidence region of North China.
25695595 2015 Ku70 is essential for histone deacetylase inhibitor trichostatin A-induced apoptosis.
25670504 2015 Interactome analysis identifies a new paralogue of XRCC4 in non-homologous end joining DNA repair pathway.
25574025 2015 DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair.
25569644 2015 Association between the XRCC6 polymorphisms and cancer risks: a systematic review and meta-analysis.
25299772 2014 SMAR1 coordinates HDAC6-induced deacetylation of Ku70 and dictates cell fate upon irradiation.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25046228 DNA-PKcs and Ku70 are predictive markers for poor prognosis of patients with gall bladder malignancies.
25000480 2014 Use of phage display to identify novel mineralocorticoid receptor-interacting proteins.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24942867 2014 RECQ helicase RECQL4 participates in non-homologous end joining and interacts with the Ku complex.
24769731 2014 Role of Ku70 in deubiquitination of Mcl-1 and suppression of apoptosis.
24615008 2014 Association between polymorphisms at promoters of XRCC5 and XRCC6 genes and risk of breast cancer.
24610814 2014 A human short open reading frame (sORF)-encoded polypeptide that stimulates DNA end joining.
24382701 2014 Comprehensive analyses of DNA repair pathways, smoking and bladder cancer risk in Los Angeles and Shanghai.
24324074 2013 Association of X-ray repair cross-complementing-6 genotypes with childhood leukemia.
24305947 2014 Inhibition of Ku70 acetylation by INHAT subunit SET/TAF-I? regulates Ku70-mediated DNA damage response.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24187467 2013 Abnormal DNA-PKcs and Ku 70/80 expression may promote malignant pathological processes in gastric carcinoma.
24095731 2013 TRF2 interaction with Ku heterotetramerization interface gives insight into c-NHEJ prevention at human telomeres.
23745766 2013 Association between the XRCC6 Promoter rs2267437 polymorphism and cancer risk: evidence based on the current literature.
23685356 2013 HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment.
23677788 2013 Lytic infection of Kaposi's sarcoma-associated herpesvirus induces DNA double-strand breaks and impairs non-homologous end joining.
23650516 2013 Human RECQ1 interacts with Ku70/80 and modulates DNA end-joining of double-strand breaks.
23624778 2013 Clinicopathological significance of KU70/KU80, a key DNA damage repair protein in breast cancer.
23620595 2013 Cooperative assembly of a protein-DNA filament for nonhomologous end joining.
23457464 2013 Systems modelling of NHEJ reveals the importance of redox regulation of Ku70/80 in the dynamics of dna damage foci.
23393345 2013 The contribution of XRCC6/Ku70 to hepatocellular carcinoma in Taiwan.
23349316 2013 Castration therapy results in decreased Ku70 levels in prostate cancer.
23322783 2013 The N-terminal region of the DNA-dependent protein kinase catalytic subunit is required for its DNA double-stranded break-mediated activation.
23271361 2013 Quantitative assessment of the association between XRCC6 C1310G polymorphism and cancer risk.
23247197 2013 Ku70 acetylation and modulation of c-Myc/ATF4/CHOP signaling axis by SIRT1 inhibition lead to sensitization of HepG2 cells to TRAIL through induction of DR5 and down-regulation of c-FLIP.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23154512 2012 Loss of expression of the double strand break repair protein ATM is associated with worse prognosis in colorectal cancer and loss of Ku70 expression is associated with CIN.
23098447 2012 Association between XRCC5, 6 and 7 gene polymorphisms and the risk of breast cancer: a HuGE review and meta-analysis.
22993329 2012 The role of XRCC6 T-991C functional polymorphism in renal cell carcinoma.
22745744 2012 Interaction of caveolin-1 with Ku70 inhibits Bax-mediated apoptosis.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22617044 2012 The effect of DN (dominant-negative) Ku70 and reoxygenation on hypoxia cell-kill: evidence of hypoxia-induced potentially lethal damage.
22593040 2012 A functional polymorphism C-1310G in the promoter region of Ku70/XRCC6 is associated with risk of renal cell carcinoma.
22535209 2012 DNA ends alter the molecular composition and localization of Ku multicomponent complexes.
22524845 2012 Association between the Ku70-1310C/G promoter polymorphism and cancer risk: a meta-analysis.
22455395 2012 Association of Ku70 A-31G polymorphism and risk of renal cell carcinoma in a Chinese population.
22442688 2012 Deformed epidermal autoregulatory factor-1 (DEAF1) interacts with the Ku70 subunit of the DNA-dependent protein kinase complex.
22399625 2012 Association of DNA double-strand break gene XRCC6 genotypes and lung cancer in Taiwan.
22226402 2012 International cohort study of 73 anti-Ku-positive patients: association of p70/p80 anti-Ku antibodies with joint/bone features and differentiation of disease populations by using principal-components analysis.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22179609 2012 Human Ku70/80 protein blocks exonuclease 1-mediated DNA resection in the presence of human Mre11 or Mre11/Rad50 protein complex.
22037767 2012 Ku regulates signaling to DNA damage response pathways through the Ku70 von Willebrand A domain.
21972126 2012 Telomere maintenance genes SIRT1 and XRCC6 impact age-related decline in telomere length but only SIRT1 is associated with human longevity.
21756904 2011 KARP-1 works as a heterodimer with Ku70, but the function of KARP-1 cannot perfectly replace that of Ku80 in DSB repair.
21679440 2011 Concordant and opposite roles of DNA-PK and the "facilitator of chromatin transcription" (FACT) in DNA repair, apoptosis and necrosis after cisplatin.
21671178 2011 Contribution of decreased expression of Ku70 to enhanced radiosensitivity by sodium butyrate in glioblastoma cell line (U251).
21575865 2011 Mechanistic rationale for inhibition of poly(ADP-ribose) polymerase in ETS gene fusion-positive prostate cancer.
21575261 2011 Genetic polymorphisms of DNA double strand break gene Ku70 and gastric cancer in Taiwan.
21556760 2012 The Ku70 -1310C/G promoter polymorphism is associated with breast cancer susceptibility in Chinese Han population.
21521024 2011 Role of the XRCC5/XRCC6 dimer in carcinogenesis and pharmacogenomics.
21512205 2011 Depletion of Ku70/80 reduces the levels of extrachromosomal telomeric circles and inhibits proliferation of ALT cells.
21423092 2011 Is there any association between TACSTD2, KIAA1253, Ku70 and mutant KRAS gene expression and clinical-pathological features of colorectal cancer?
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21398614 2011 Cutting edge: Ku70 is a novel cytosolic DNA sensor that induces type III rather than type I IFN.
21349273 2011 Functional significance of the interaction with Ku in DNA double-strand break recognition of XLF.
21304054 2011 Genetic polymorphisms in DNA double-strand break repair genes XRCC5, XRCC6 and susceptibility to hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21256093 2011 Competition between PARP-1 and Ku70 control the decision between high-fidelity and mutagenic DNA repair.
21146485 2011 Identification of cyclophilin-40-interacting proteins reveals potential cellular function of cyclophilin-40.
21116096 2010 Early increase of radiation-induced ?H2AX foci in a human Ku70/80 knockdown cell line characterized by an enhanced radiosensitivity.
21108727 2011 Restoration of senescent human diploid fibroblasts by modulation of the extracellular matrix.
21107697 2011 Ku70 and Rad51 vary in their importance for the repair of doxorubicin- versus etoposide-induced DNA damage.
21070772 2010 Coilin interacts with Ku proteins and inhibits in vitro non-homologous DNA end joining.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
21042724 2010 Low expression of Ku70/80, but high expression of DNA-PKcs, predict good response to radiotherapy in early breast cancer.
20718578 2011 The human Ku autoantigen shares amino acid sequence homology with fungal, but not bacterial and viral, proteins.
20711232 2010 Regulation of DNA-dependent protein kinase by protein kinase CK2 in human glioblastoma cells.
20697560 2010 Ku70 acetylation in neuroblastoma pathogenesis and therapy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20610542 2010 Gamma-radiation sensitivity and polymorphisms in RAD51L1 modulate glioma risk.
20570964 2010 The DNA damage repair protein Ku70 interacts with FOXO4 to coordinate a conserved cellular stress response.
20538911 2010 Ku70 corrupts DNA repair in the absence of the Fanconi anemia pathway.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20496270 2010 Analysis of the polymorphisms in non-homologous DNA end joining (NHEJ) gene Ku70 and Ligase IV in sporadic breast cancer in women.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20493174 2010 55K isoform of CDK9 associates with Ku70 and is involved in DNA repair.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20383123 2010 Ku is a 5'-dRP/AP lyase that excises nucleotide damage near broken ends.
20368362 2010 DDB2 complex-mediated ubiquitylation around DNA damage is oppositely regulated by XPC and Ku and contributes to the recruitment of XPA.
20127252 2010 Expression of TRF1, TRF2, TIN2, TERT, KU70, and BRCA1 proteins is associated with telomere shortening and may contribute to multistage carcinogenesis of gastric cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20047046 2010 Exogenously expressed human Ku70 stabilizes Ku80 in Xenopus oocytes and induces heterologous DNA-PK catalytic activity.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19906305 2009 Ku proteins interact with activator protein-2 transcription factors and contribute to ERBB2 overexpression in breast cancer cell lines.
19809793 2010 Distribution, cellular localization, and therapeutic potential of the tumor-associated antigen Ku70/80 in glioblastoma multiforme.
19794960 2009 A nonhomologous end-joining pathway is required for protein phosphatase 2A promotion of DNA double-strand break repair.
19692349 2009 Ku70 regulates Bax-mediated pathogenesis in laminin-alpha2-deficient human muscle cells and mouse models of congenital muscular dystrophy.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19672258 2009 Radioresistant cervical cancer shows upregulation of the NHEJ proteins DNA-PKcs, Ku70 and Ku86.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19467273 2009 Hepatitis C virus-core protein facilitates the degradation of Ku70 and reduces DNA-PK activity in hepatocytes.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19408343 2009 Lung cancer susceptibility and prognosis associated with polymorphisms in the nonhomologous end-joining pathway genes: a multiple genotype-phenotype study.
19303849 2009 A role of DNA-PK for the metabolic gene regulation in response to insulin.
19265193 2009 p53 acetylation is crucial for its transcription-independent proapoptotic functions.
19251090 2009 Acute normal tissue reactions in head-and-neck cancer patients treated with IMRT: influence of dose and association with genetic polymorphisms in DNA DSB repair genes.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19219618 2009 A polymorphism in the promoter region of Ku70/XRCC6, associated with breast cancer risk and oestrogen exposure.
19181665 2009 Poly(ADP-ribose) Polymerase 1 Interacts with Nuclear Respiratory Factor 1 (NRF-1) and Plays a Role in NRF-1 Transcriptional Regulation.
19177010 2009 Interleukin-6 affects cell death escaping mechanisms acting on Bax-Ku70-Clusterin interactions in human colon cancer progression.
19135898 2009 Purification of proteins associated with specific genomic Loci.
19134120 2009 Rickettsial outer-membrane protein B (rOmpB) mediates bacterial invasion through Ku70 in an actin, c-Cbl, clathrin and caveolin 2-dependent manner.
19116388 2009 A field synopsis on low-penetrance variants in DNA repair genes and cancer susceptibility.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18990028 Genotype-phenotype relationship between DNA repair gene genetic polymorphisms and DNA repair capacity.
18809223 2008 Expression of apolipoprotein C-IV is regulated by Ku antigen/peroxisome proliferator-activated receptor gamma complex and correlates with liver steatosis.
18768166 2008 Single-nucleotide polymorphisms in DNA double-strand break repair genes: association with head and neck cancer and interaction with tobacco use and alcohol consumption.
18757043 2008 Ku antigen interacts with abasic sites.
18710952 2008 The catalytic subunit of DNA-dependent protein kinase regulates proliferation, telomere length, and genomic stability in human somatic cells.
18706726 2008 Hypoxia downregulates Ku70/80 expression in cervical carcinoma tumors.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18546291 2008 Ku70 predicts response and primary tumor recurrence after therapy in locally advanced head and neck cancer.
18487076 2008 Oral cancer and genetic polymorphism of DNA double strand break gene Ku70 in Taiwan.
18374504 2008 Influence of multiple genetic polymorphisms on genitourinary morbidity after carbon ion radiotherapy for prostate cancer.
18362350 2008 Regulation of the proapoptotic factor Bax by Ku70-dependent deubiquitylation.
18303113 2008 Transcriptome sequencing of malignant pleural mesothelioma tumors.
18208821 2008 Association of autoantibodies with Ku and DNA repair proteins in connective tissue diseases.
18164703 2008 Accumulation of Ku80 proteins at DNA double-strand breaks in living cells.
18000863 2008 Polymorphisms in nonhomologous end-joining genes associated with breast cancer risk and chromosomal radiosensitivity.
17982634 2007 Immunohistochemical analysis of Ku70/86 expression of breast cancer tissues.
17971348 2008 hOGG1(326), XRCC1(399) and XRCC3(241) polymorphisms influence micronucleus frequencies in human lymphocytes in vivo.
17952468 2008 Prognostic importance of DNA repair gene polymorphisms of XRCC1 Arg399Gln and XPD Lys751Gln in lung cancer patients from India.
17885668 2007 Bax-inhibiting peptide protects cells from polyglutamine toxicity caused by Ku70 acetylation.
17768380 2007 Pterygium and genetic polymorphism of DNA double strand break repair gene Ku70.
17714764 2007 Age-related transcription levels of KU70, MGST1 and BIK in CD34+ hematopoietic stem and progenitor cells.
17671430 2007 Bin1 interacts with and restrains the DNA end-binding protein complex Ku.
17617666 2007 Nerve growth factor receptor TrkA signaling in breast cancer cells involves Ku70 to prevent apoptosis.
17496833 2007 Transport of the leaderless protein Ku on the cell surface of activated monocytes regulates their migratory abilities.
17479409 2007 Arsenite-induced alterations in Ku70-deficient cells: a model to study genotoxic effects.
17389609 2007 Tagging SNPs in non-homologous end-joining pathway genes and risk of glioma.
17334224 2007 SIRT1 promotes DNA repair activity and deacetylation of Ku70.
17308091 2007 A role for the HOXB7 homeodomain protein in DNA repair.
17283121 2007 Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17202845 2006 Decreased expression of DNA repair proteins Ku70 and Mre11 is associated with aging and may contribute to the cellular senescence.
17187679 2006 Identification of poly(ADP-ribose)polymerase-1 and Ku70/Ku80 as transcriptional regulators of S100A9 gene expression.
17159921 2007 Structural model of full-length human Ku70-Ku80 heterodimer and its recognition of DNA and DNA-PKcs.
17124166 2006 Dynamic assembly of end-joining complexes requires interaction between Ku70/80 and XRCC4.
16857680 2006 Interplay between Ku, Artemis, and the DNA-dependent protein kinase catalytic subunit at DNA ends.
16713581 2006 Three-dimensional structure of the human DNA-PKcs/Ku70/Ku80 complex assembled on DNA and its implications for DNA DSB repair.
16448389 2006 Effect of Ku proteins on IRES-mediated translation.
16440001 2006 Granzyme A, which causes single-stranded DNA damage, targets the double-strand break repair protein Ku70.
16360032 2005 Ku70, a component of DNA-dependent protein kinase, is a mammalian receptor for Rickettsia conorii.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16291214 2005 Retroviral DNA integration--mechanism and consequences.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
15958648 2005 Genetic polymorphisms of selected DNA repair genes, estrogen and progesterone receptor status, and breast cancer risk.
15905197 2005 Justicidin A decreases the level of cytosolic Ku70 leading to apoptosis in human colorectal cancer cells.
15827325 2005 Ku protein targeting by Ku70 small interfering RNA enhances human cancer cell response to topoisomerase II inhibitor and gamma radiation.
15824061 2005 Human Ku70/80 interacts directly with hTR, the RNA component of human telomerase.
15782130 2005 BARD1 induces apoptosis by catalysing phosphorylation of p53 by DNA-damage response kinase.
15723802 2005 Vigilins bind to promiscuously A-to-I-edited RNAs and are involved in the formation of heterochromatin.
15640154 2005 Ku is a novel transcriptional recycling coactivator of the androgen receptor in prostate cancer cells.
15635413 2005 Nucleolar proteome dynamics.
15613478 2005 Actinomycin D induces histone gamma-H2AX foci and complex formation of gamma-H2AX with Ku70 and nuclear DNA helicase II.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15383534 2004 Telosome, a mammalian telomere-associated complex formed by multiple telomeric proteins.
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15220460 2004 A human cellular protein activity (OF-1), which binds herpes simplex virus type 1 origin, contains the Ku70/Ku80 heterodimer.
15205477 2004 Calorie restriction promotes mammalian cell survival by inducing the SIRT1 deacetylase.
15159402 2004 Identification of interaction partners and substrates of the cyclin A1-CDK2 complex.
15123719 2004 Ku70/Ku80 and DNA-dependent protein kinase catalytic subunit modulate RAG-mediated cleavage: implications for the enforcement of the 12/23 rule.
15100233 2004 The human Rap1 protein complex and modulation of telomere length.
15075319 2004 Positive and negative modulation of the transcriptional activity of the ETS factor ESE-1 through interaction with p300, CREB-binding protein, and Ku 70/86.
15019772 2004 The Membrane-associated form of the DNA repair protein Ku is involved in cell adhesion to fibronectin.
14991539 2004 Application of new in situ hybridization probes for Ku70 and Ku80 in tissue microarrays of paraffin-embedded malignant melanomas: correlation with immunohistochemical analysis.
14734561 2004 Identification and biochemical characterization of a Werner's syndrome protein complex with Ku70/80 and poly(ADP-ribose) polymerase-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14627815 2003 DNA-PK is activated by nucleosomes and phosphorylates H2AX within the nucleosomes in an acetylation-dependent manner.
14570916 2004 The Ku antigen-recombination signal-binding protein Jkappa complex binds to the nuclear factor-kappaB p50 promoter and acts as a positive regulator of p50 expression in human gastric cancer cells.
12867423 2003 Oxidative stress induces nuclear loss of DNA repair proteins Ku70 and Ku80 and apoptosis in pancreatic acinar AR42J cells.
12756247 2003 Regulatory interactions between the checkpoint kinase Chk1 and the proteins of the DNA-dependent protein kinase complex.
12750264 2003 Breast cancer risk associated with genotypic polymorphism of the nonhomologous end-joining genes: a multigenic study on cancer susceptibility.
12672812 2003 Selective inhibition of class switching to IgG and IgE by recruitment of the HoxC4 and Oct-1 homeodomain proteins and Ku70/Ku86 to newly identified ATTT cis-elements.
12664629 2002 Divergence in intracellular signaling between interleukin-4 (IL-4) and IL-13 in human cells localizes to monomeric/dimeric expression of a transcription factor, the lupus autoantigen 70/80, induced by both cytokines.
12664628 2002 KU 70/80 lupus autoantigen is the transcription factor induced by interleukins (IL)-13 and -4 leading to induction of 15-lipoxygenase (15-LO) in human cells.
12547193 2003 Coordinated assembly of Ku and p460 subunits of the DNA-dependent protein kinase on DNA ends is necessary for XRCC4-ligase IV recruitment.
12519782 2003 Nuclear receptor coactivator thyroid hormone receptor-binding protein (TRBP) interacts with and stimulates its associated DNA-dependent protein kinase.
12518983 2002 Dimerization, translocation and localization of Ku70 and Ku80 proteins.
12509254 2002 Defining interactions between DNA-PK and ligase IV/XRCC4.
12494870 Relationship between DNA mismatch repair genes expression, Ku-genes expression and ploidy-related parameters in the progression of pigmented lesions of the skin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12467650 2003 Human neutrophils isolated from peripheral blood contain Ku protein but not DNA-dependent protein kinase.
12377759 2002 Human Ku70/80 associates physically with telomerase through interaction with hTERT.
12368356 2002 Implication of the lymphocyte-specific nuclear body protein Sp140 in an innate response to human immunodeficiency virus type 1.
12324457 2002 Expression of Ku70 and Ku80 mediated by NF-kappa B and cyclooxygenase-2 is related to proliferation of human gastric cancer cells.
12177300 2002 Ku heterodimer binds to both ends of the Werner protein and functional interaction occurs at the Werner N-terminus.
12171929 2002 A proteomics approach to identify proliferating cell nuclear antigen (PCNA)-binding proteins in human cell lysates. Identification of the human CHL12/RFCs2-5 complex as a novel PCNA-binding protein.
12145309 2002 Direct binding of AP-1 (Fos/Jun) proteins to a SMAD binding element facilitates both gonadotropin-releasing hormone (GnRH)- and activin-mediated transcriptional activation of the mouse GnRH receptor gene.
12145308 2002 Dorfin ubiquitylates mutant SOD1 and prevents mutant SOD1-mediated neurotoxicity.
12145307 2002 The Keap1 BTB/POZ dimerization function is required to sequester Nrf2 in cytoplasm.
12145306 2002 Regulation of osteocalcin gene expression by a novel Ku antigen transcription factor complex.
12091904 2002 Charting HIV's remarkable voyage through the cell: Basic science as a passport to future therapy.
12065431 2002 Synapsis of DNA ends by DNA-dependent protein kinase.
12023295 2002 Conversion of phosphoglycolate to phosphate termini on 3' overhangs of DNA double strand breaks by the human tyrosyl-DNA phosphodiesterase hTdp1.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11749722 2001 Involvement of DNA-dependent protein kinase in regulation of stress-induced JNK activation.
11493912 2001 Structure of the Ku heterodimer bound to DNA and its implications for double-strand break repair.
11457852 2001 The three-dimensional structure of the C-terminal DNA-binding domain of human Ku70.
11406603 2001 Role of the non-homologous DNA end joining pathway in the early steps of retroviral infection.
11328876 2001 A functional interaction of Ku with Werner exonuclease facilitates digestion of damaged DNA.
11314007 2001 Tumor specific modulation of KU70/80 DNA binding activity in breast and bladder human tumor biopsies.
11279128 2001 The binding of Ku antigen to homeodomain proteins promotes their phosphorylation by DNA-dependent protein kinase.
11239001 2001 Chromatin-bound PCNA complex formation triggered by DNA damage occurs independent of the ATM gene product in human cells.
11238996 2001 Human securin, hPTTG, is associated with Ku heterodimer, the regulatory subunit of the DNA-dependent protein kinase.
11162511 2001 Repression of the HSP70B promoter by NFIL6, Ku70, and MAPK involves three complementary mechanisms.
11158303 2001 Wortmannin potentiates integrase-mediated killing of lymphocytes and reduces the efficiency of stable transduction by retroviruses.
11112778 2001 Human Ku70 interacts with heterochromatin protein 1alpha.
11070027 2000 DNA-Dependent protein kinase is not required for efficient lentivirus integration.
10984620 2000 Interaction of human Ku70 with TRF2.
10783163 2000 Ku complex interacts with and stimulates the Werner protein.
10757784 2000 Ku recruits the XRCC4-ligase IV complex to DNA ends.
10750018 2000 Association of the Ku autoantigen/DNA-dependent protein kinase holoenzyme and poly(ADP-ribose) polymerase with the DNA binding domain of progesterone receptors.
10591208 1999 The DNA sequence of human chromosome 22.
10570175 1999 Association of terminal deoxynucleotidyl transferase with Ku.
10514012 1999 Ku in the cytoplasm associates with CD40 in human B cells and translocates into the nucleus following incubation with IL-4 and anti-CD40 mAb.
10508516 1999 Mre11 and Ku70 interact in somatic cells, but are differentially expressed in early meiosis.
10446239 1999 Mapping of protein-protein interactions within the DNA-dependent protein kinase complex.
10409678 1999 Ku binds telomeric DNA in vitro.
10377944 1999 Ku, a DNA repair protein with multiple cellular functions?
10219089 1999 Isolation of Ku70-binding proteins (KUBs).
10213687 1999 A role for DNA-PK in retroviral DNA integration.
10207052 1999 The C terminus of Ku80 activates the DNA-dependent protein kinase catalytic subunit.
10026262 1999 DNA-dependent protein kinase phosphorylation sites in Ku 70/80 heterodimer.
9914162 1999 The Ku70 autoantigen interacts with p40phox in B lymphocytes.
9826654 1998 DNA end-joining catalyzed by human cell-free extracts.
9798959 1998 Expression, localization and functional interactions of Ku70 subunit of DNA-PK in peripheral lymphocytes and Nalm-19 cells after irradiation.
9742108 1998 Productive and nonproductive complexes of Ku and DNA-dependent protein kinase at DNA termini.
9488450 1998 Repression of GCN5 histone acetyltransferase activity via bromodomain-mediated binding and phosphorylation by the Ku-DNA-dependent protein kinase complex.
9430697 1998 Physical interaction between epidermal growth factor receptor and DNA-dependent protein kinase in mammalian cells.
9362500 1997 Double-strand break repair by Ku70 requires heterodimerization with Ku80 and DNA binding functions.
9312071 1997 Binding of Ku and c-Abl at the kinase homology region of DNA-dependent protein kinase catalytic subunit.
9223317 1997 Ku70-deficient embryonic stem cells have increased ionizing radiosensitivity, defective DNA end-binding activity, and inability to support V(D)J recombination.
9200330 1997 The end-joining reaction in V(D)J recombination.
8954777 1996 Chromosomal localization of the mouse and rat DNA double-strand break repair genes Ku p70 and Ku p80/XRCC5 and their mRNA expression in various mouse tissues.
8702520 1996 Expression of human glucocorticoid receptor gene and interaction of nuclear proteins with the transcriptional control element.
8621488 1996 The interaction between Ku antigen and REF1 protein mediates negative gene regulation by extracellular calcium.
8605992 1996 Non-histone protein 1 (NHP1) is a member of the Ku protein family which is upregulated in differentiating mouse myoblasts and human promyelocytes.
8524317 1996 p95vav associates with the nuclear protein Ku-70.
8240370 1993 Lupus autoantigen Ku protein binds HIV-1 TAR RNA in vitro.
7957065 1994 Human DNA helicase II: a novel DNA unwinding enzyme identified as the Ku autoantigen.
7882982 1995 Purification of the sequence-specific transcription factor CTCBF, involved in the control of human collagen IV genes: subunits with homology to Ku antigen.
2917966 1989 Cloning and characterization of a cDNA that encodes a 70-kDa novel human thyroid autoantigen.
2466842 1989 Molecular cloning of cDNA encoding the p70 (Ku) lupus autoantigen.
1639139 1992 Immunolocalization of Ku-proteins (p80/p70): localization of p70 to nucleoli and periphery of both interphase nuclei and metaphase chromosomes.
1608402 1992 Nucleotide sequence and genomic structure analyses of the p70 subunit of the human Ku autoantigen: evidence for a family of genes encoding Ku (p70)-related polypeptides.
1537839 1992 Identification of proteins binding to interferon-inducible transcriptional enhancers in hematopoietic cells.