Property Summary

NCBI Gene PubMed Count 271
PubMed Score 470.82
PubTator Score 369.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.262 1.1e-08
atypical teratoid / rhabdoid tumor 1.300 1.4e-08
Breast cancer 2.700 3.6e-02
breast carcinoma 1.500 4.4e-03
glioblastoma 1.100 1.2e-08
group 3 medulloblastoma 1.200 6.7e-05
lung cancer 1.500 3.0e-04
medulloblastoma, large-cell 1.500 8.6e-07
Multiple myeloma 1.101 1.3e-03
osteosarcoma -1.130 7.2e-03
ovarian cancer -1.200 2.5e-03
pediatric high grade glioma 1.300 3.0e-07
primitive neuroectodermal tumor 1.100 9.0e-06
Waldenstrons macroglobulinemia 1.568 2.5e-03

Synonym

Accession P13010 A8K3X5 Q0Z7V0 Q4VBQ5 Q53HH7 Q7M4N0 Q9UCQ0 Q9UCQ1
Symbols KU80
KUB2
Ku86
NFIV
KARP1
KARP-1

Gene

Protein-protein Interaction (1)

Gene RIF (185)

AA Sequence

MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSG      1 - 70
GDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSS     71 - 140
RFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKM    141 - 210
VMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVD    211 - 280
AKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQ    281 - 350
VQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLV    351 - 420
YVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRL    421 - 490
FQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHED    491 - 560
GPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETP    561 - 630
YFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEE    631 - 700
AKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI                                          701 - 732
//

Text Mined References (284)

PMID Year Title