Property Summary

NCBI Gene PubMed Count 12
PubMed Score 28.75
PubTator Score 10.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
nasopharyngeal carcinoma 1056 1.1e-05
Breast cancer 3098 2.7e-02

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 3.200 2.7e-02
nasopharyngeal carcinoma 1.300 1.1e-05

Gene RIF (4)

PMID Text
24556695 Exportin-t-mediated nuclear-cytoplasmic transport of the eEF1A/Nef complexes in monocyte-derived macrophages is invloved in the inhibition of apoptosis triggered by stress
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17224653 Exportin-t preferentially binds and exports those tRNAs that are rapidly consumed by the protein synthesis machinery.
16707848 Results suggest that decreased expression of exportin-1 and exportin-t induced by 1alpha,25-dihydroxyvitamin D3 can be correlated to inhibition of the proliferation of HL-60 cells.

AA Sequence

MDEQALLGLNPNADSDFRQRALAYFEQLKISPDAWQVCAEALAQRTYSDDHVKFFCFQVLEHQVKYKYSE      1 - 70
LTTVQQQLIRETLISWLQAQMLNPQPEKTFIRNKAAQVFALLFVTEYLTKWPKFFFDILSVVDLNPRGVD     71 - 140
LYLRILMAIDSELVDRDVVHTSEEARRNTLIKDTMREQCIPNLVESWYQILQNYQFTNSEVTCQCLEVVG    141 - 210
AYVSWIDLSLIANDRFINMLLGHMSIEVLREEACDCLFEVVNKGMDPVDKMKLVESLCQVLQSAGFFSID    211 - 280
QEEDVDFLARFSKLVNGMGQSLIVSWSKLIKNGDIKNAQEALQAIETKVALMLQLLIHEDDDISSNIIGF    281 - 350
CYDYLHILKQLTVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLLLDRLAQVSP    351 - 420
ELLLASVRRVFSSTLQNWQTTRFMEVEVAIRLLYMLAEALPVSHGAHFSGDVSKASALQDMMRTLVTSGV    421 - 490
SSYQHTSVTLEFFETVVRYEKFFTVEPQHIPCVLMAFLDHRGLRHSSAKVRSRTAYLFSRFVKSLNKQMN    491 - 560
PFIEDILNRIQDLLELSPPENGHQSLLSSDDQLFIYETAGVLIVNSEYPAERKQALMRNLLTPLMEKFKI    561 - 630
LLEKLMLAQDEERQASLADCLNHAVGFASRTSKAFSNKQTVKQCGCSEVYLDCLQTFLPALSCPLQKDIL    631 - 700
RSGVRTFLHRMIICLEEEVLPFIPSASEHMLKDCEAKDLQEFIPLINQITAKFKIQVSPFLQQMFMPLLH    701 - 770
AIFEVLLRPAEENDQSAALEKQMLRRSYFAFLQTVTGSGMSEVIANQGAENVERVLVTVIQGAVEYPDPI    771 - 840
AQKTCFIILSKLVELWGGKDGPVGFADFVYKHIVPACFLAPLKQTFDLADAQTVLALSECAVTLKTIHLK    841 - 910
RGPECVQYLQQEYLPSLQVAPEIIQEFCQALQQPDAKVFKNYLKVFFQRAKP                      911 - 962
//

Text Mined References (18)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17224653 2006 Interaction of immobilized human exportin-t with calf liver tRNA.
16707848 2006 1,25-Dihydroxyvitamin D3 suppresses exportin expression in human promyelocytic leukemia HL-60 cells.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12138183 2002 Steady-state nuclear localization of exportin-t involves RanGTP binding and two distinct nuclear pore complex interaction domains.
11024021 2000 Identification of two novel RanGTP-binding proteins belonging to the importin beta superfamily.
10657246 2000 Export and transport of tRNA are coupled to a multi-protein complex.
9857198 1998 The role of exportin-t in selective nuclear export of mature tRNAs.
9660920 1998 Identification of a tRNA-specific nuclear export receptor.
9512417 1998 Identification of a nuclear export receptor for tRNA.