Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.11
PubTator Score 6.38

Knowledge Summary


No data available


  Differential Expression (15)

Disease log2 FC p
interstitial lung disease 1.200 8.6e-03
astrocytic glioma 1.700 2.3e-03
ependymoma 1.400 7.1e-03
oligodendroglioma 1.500 1.0e-03
osteosarcoma -2.330 3.6e-05
medulloblastoma, large-cell 1.400 4.5e-04
intraductal papillary-mucinous adenoma (... 2.300 3.3e-04
intraductal papillary-mucinous carcinoma... 1.900 1.3e-03
intraductal papillary-mucinous neoplasm ... 1.500 3.3e-02
group 3 medulloblastoma 1.200 4.6e-03
subependymal giant cell astrocytoma -1.639 4.8e-02
Pick disease 1.500 1.3e-05
Breast cancer -1.200 8.2e-08
ovarian cancer -1.500 2.7e-12
Gaucher disease type 1 -1.500 3.2e-02

Gene RIF (7)

25911113 Knockdown of exportins 4, 5, and 7 altered thyroid hormone receptor shuttling dynamics, and when exportins 5 and 7 were overexpressed, TR distribution shifted toward the cytosol.
25694352 Human oligodendrogliomas cells stably expressing mutant XPO7 showed altered cell proliferation.
24625450 RAN nucleo-cytoplasmic transport and mitotic spindle assembly partners XPO7 and TPX2 have roles in serous epithelial ovarian cancer
23906023 Knockdown of XPO7 reduced the amount of nuclear p65 following TNF stimulation. XPO7 binding to p65 is NLS independent
20503194 These biochemical and functional data reveal RANBP16 and RANBP17 as novel regulators of E2A protein action, and demonstrate specific interaction of E12 with RANBP17.
18256292 STRADalpha facilitates nuclear export of LKB1 by serving as an adaptor between LKB1 and exportins CRM1 and exportin7.
15282546 Exportin 7-dependent nuclear export signals differ fundamentally from the leucine-rich, CRM1-dependent ones

AA Sequence

LTKNRDRFTQNLSAFRREVNDSMKNSTYGVNSNDMMS                                    1051 - 1087

Text Mined References (20)

PMID Year Title
25911113 2015 Multiple exportins influence thyroid hormone receptor localization.
25694352 2015 Tumor-specific mutations in low-frequency genes affect their functional properties.
25416956 2014 A proteome-scale map of the human interactome network.
24625450 2014 RAN nucleo-cytoplasmic transport and mitotic spindle assembly partners XPO7 and TPX2 are new prognostic biomarkers in serous epithelial ovarian cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23906023 2013 KPNB1, XPO7 and IPO8 mediate the translocation ofNF-?B/p65 into the nucleus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22509282 2012 Assessment of the red cell proteome of young patients with unexplained hemolytic anemia by two-dimensional differential in-gel electrophoresis (DIGE).
21269460 2011 Initial characterization of the human central proteome.
20503194 2010 Identification of RANBP16 and RANBP17 as novel interaction partners for the bHLH transcription factor E12.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18256292 2008 STRADalpha regulates LKB1 localization by blocking access to importin-alpha, and by association with Crm1 and exportin-7.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15282546 2004 Exportin 7 defines a novel general nuclear export pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11071879 2000 Identification of a novel putative Ran-binding protein and its close homologue.
11024021 2000 Identification of two novel RanGTP-binding proteins belonging to the importin beta superfamily.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.