Property Summary

NCBI Gene PubMed Count 46
PubMed Score 74.14
PubTator Score 64.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.200 2.0e-03
ependymoma 1.300 2.6e-03
oligodendroglioma 1.400 2.2e-03
group 3 medulloblastoma 1.900 3.0e-07
atypical teratoid / rhabdoid tumor 1.700 1.3e-08
glioblastoma 1.200 5.8e-06
medulloblastoma, large-cell 2.300 1.0e-05
primitive neuroectodermal tumor 1.500 6.3e-06
non-small cell lung cancer 1.308 1.4e-15
ovarian cancer 1.100 6.3e-05

Gene RIF (28)

PMID Text
26976605 XPO5 role in microRNA biogenesis
26878725 NUP93 and exportin 5 interact with the signaling protein SMAD4 and that NUP93 mutations abrogated interaction with SMAD4
26147304 Variations in XPO5 rs11077 of Korean patients are significantly associated with their risk of colorectal cancer.
25911113 Knockdown of exportins 4, 5, and 7 altered thyroid hormone receptor shuttling dynamics, and when exportins 5 and 7 were overexpressed, TR distribution shifted toward the cytosol.
24209753 eEF1A binds to Snail transcription factors when bound to their main target, the E-cadherin promoter, facilitating their export to the cytoplasm in association with the aa-tRNA-Exportin5 complex.
24057215 The study identifies a miR-138-RMND5A-Exportin-5 as a previously unknown miRNA processing regulatory pathway in HeLa cells.
23549446 data demonstrate that the exportin 5 (XPO5) rs2257082 T variant allele occurs more frequently in primary ovarian insufficiency (POI)patients than in controls, suggesting that this allele may be associated with increased POI risk
22766726 Dicer, Drosha, and Exportin 5 genes were up-regulated in bladder urothelial carcinoma compared to normal urothelium. Silencing these genes induced cell proliferation inhibition and apoptosis in bladder urothelial carcinoma cells.
22539802 overall survival was significantly longer in multiple myeloma patients with C/C or A/C variant in the XPO5 gene single nucleotide polymorphism site rs11077
22190034 HIV-1 Vpu is identified to have a physical interaction with exportin 5 (XPO5) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21297638 Exportin-5 controls Dicer1 expression post-transcriptionally.
21048991 Data show a requirement for the export receptor Exportin 5 in nuclear export of 60S subunits in human cells, and that Exp5 binds to pre-60S particles in a RanGTP-dependent manner.
20951941 The restoration of XPO5 functions reverses the impaired export of pre-miRNAs and has tumor-suppressor features.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20732906 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20721975 Observational study of gene-disease association. (HuGE Navigator)
20585341 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20211803 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19965479 2.9 angstrom structure of the pre-miRNA nuclear export machinery formed by pre-miRNA complexed with Exp-5 and RanGTP; RNA recognition by Exp-5:RanGTP does not depend on RNA sequence, implying that Exp-5:RanGTP can recognize a variety of pre-miRNAs
19138993 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19124606 Each of the dsRBDs in ADAR1 interacts with the export factor exportin-5.
19047128 Observational study of gene-disease association. (HuGE Navigator)
15254228 exportin-5 has a role in exporting JAZ from the cell nucleus
14631048 exportin-5 is key to microRNA biogenesis and may help coordinate nuclear and cytoplasmic processing steps
14570900 exportin-5 has a role in nuclear export of ILF3 (interleukin enhancer binding factor 3)
12426393 Eukaryotic elongation factor 1A (eEF1A) and tRNA are RanGTP-dependent binding partners of exportin-5 (Exp5). Exp5 stimulates nuclear export of eEF1A and tRNA.
12426392 Exp5 exports eEF1A via tRNA from nuclei and synergizes with other transport pathways to confine translation to the cytoplasm.

AA Sequence

MAMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEKCPICVPCGLRLAEKTQVAIVRHFGLQI      1 - 70
LEHVVKFRWNGMSRLEKVYLKNSVMELIANGTLNILEEENHIKDALSRIVVEMIKREWPQHWPDMLIELD     71 - 140
TLSKQGETQTELVMFILLRLAEDVVTFQTLPPQRRRDIQQTLTQNMERIFSFLLNTLQENVNKYQQVKTD    141 - 210
TSQESKAQANCRVGVAALNTLAGYIDWVSMSHITAENCKLLEILCLLLNEQELQLGAAECLLIAVSRKGK    211 - 280
LEDRKPLMVLFGDVAMHYILSAAQTADGGGLVEKHYVFLKRLCQVLCALGNQLCALLGADSDVETPSNFG    281 - 350
KYLESFLAFTTHPSQFLRSSTQMTWGALFRHEILSRDPLLLAIIPKYLRASMTNLVKMGFPSKTDSPSCE    351 - 420
YSRFDFDSDEDFNAFFNSSRAQQGEVMRLACRLDPKTSFQMAGEWLKYQLSTFLDAGSVNSCSAVGTGEG    421 - 490
SLCSVFSPSFVQWEAMTLFLESVITQMFRTLNREEIPVNDGIELLQMVLNFDTKDPLILSCVLTNVSALF    491 - 560
PFVTYRPEFLPQVFSKLFSSVTFETVEESKAPRTRAVRNVRRHACSSIIKMCRDYPQLVLPNFDMLYNHV    561 - 630
KQLLSNELLLTQMEKCALMEALVLISNQFKNYERQKVFLEELMAPVASIWLSQDMHRVLSDVDAFIAYVG    631 - 700
TDQKSCDPGLEDPCGLNRARMSFCVYSILGVVKRTCWPTDLEEAKAGGFVVGYTSSGNPIFRNPCTEQIL    701 - 770
KLLDNLLALIRTHNTLYAPEMLAKMAEPFTKALDMLDAEKSAILGLPQPLLELNDSPVFKTVLERMQRFF    771 - 840
STLYENCFHILGKAGPSMQQDFYTVEDLATQLLSSAFVNLNNIPDYRLRPMLRVFVKPLVLFCPPEHYEA    841 - 910
LVSPILGPLFTYLHMRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQLVRMLTREVMDLITVCCVSK    911 - 980
KGADHSSAPPADGDDEEMMATEVTPSAMAELTDLGKCLMKHEDVCTALLITAFNSLAWKDTLSCQRTTSQ    981 - 1050
LCWPLLKQVLSGTLLADAVTWLFTSVLKGLQMHGQHDGCMASLVHLAFQIYEALRPRYLEIRAVMEQIPE   1051 - 1120
IQKDSLDQFDCKLLNPSLQKVADKRRKDQFKRLIAGCIGKPLGEQFRKEVHIKNLPSLFKKTKPMLETEV   1121 - 1190
LDNDGGGLATIFEP                                                           1191 - 1204
//

Text Mined References (52)

PMID Year Title
26976605 2016 Re-evaluation of the roles of DROSHA, Export in 5, and DICER in microRNA biogenesis.
26878725 2016 Mutations in nuclear pore genes NUP93, NUP205 and XPO5 cause steroid-resistant nephrotic syndrome.
26147304 2015 3'-UTR Polymorphisms in the MiRNA Machinery Genes DROSHA, DICER1, RAN, and XPO5 Are Associated with Colorectal Cancer Risk in a Korean Population.
25911113 2015 Multiple exportins influence thyroid hormone receptor localization.
24209753 2013 eEF1A mediates the nuclear export of SNAG-containing proteins via the Exportin5-aminoacyl-tRNA complex.
24057215 2014 MiR-138 downregulates miRNA processing in HeLa cells by targeting RMND5A and decreasing Exportin-5 stability.
23549446 2013 Association of polymorphisms in microRNA machinery genes (DROSHA, DICER1, RAN, and XPO5) with risk of idiopathic primary ovarian insufficiency in Korean women.
22766726 2013 Inducing cell proliferation inhibition and apoptosis via silencing Dicer, Drosha, and Exportin 5 in urothelial carcinoma of the bladder.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22539802 2012 Impact of MiRSNPs on survival and progression in patients with multiple myeloma undergoing autologous stem cell transplantation.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21297638 2011 Competition for XPO5 binding between Dicer mRNA, pre-miRNA and viral RNA regulates human Dicer levels.
21269460 2011 Initial characterization of the human central proteome.
21048991 2010 A protein inventory of human ribosome biogenesis reveals an essential function of exportin 5 in 60S subunit export.
20951941 2010 A genetic defect in exportin-5 traps precursor microRNAs in the nucleus of cancer cells.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20732906 2010 Genetic variations in microRNA-related genes are associated with survival and recurrence in patients with renal cell carcinoma.
20721975 2010 Association of a common AGO1 variant with lung cancer risk: a two-stage case-control study.
20585341 2011 Role of primary miRNA polymorphic variants in metastatic colon cancer patients treated with 5-fluorouracil and irinotecan.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20211803 2010 Black carbon exposures, blood pressure, and interactions with single nucleotide polymorphisms in MicroRNA processing genes.
19965479 2009 A high-resolution structure of the pre-microRNA nuclear export machinery.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19138993 2008 Genetic variations in microRNA-related genes are novel susceptibility loci for esophageal cancer risk.
19124606 2009 RNA-regulated interaction of transportin-1 and exportin-5 with the double-stranded RNA-binding domain regulates nucleocytoplasmic shuttling of ADAR1.
19047128 2008 Single nucleotide polymorphisms of microRNA machinery genes modify the risk of renal cell carcinoma.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15613540 2005 Overexpression of exportin 5 enhances RNA interference mediated by short hairpin RNAs and microRNAs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254228 2004 Nucleocytoplasmic shuttling of JAZ, a new cargo protein for exportin-5.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14730017 2004 Exportin 5 is a RanGTP-dependent dsRNA-binding protein that mediates nuclear export of pre-miRNAs.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14681208 2003 Exportin-5 mediates the nuclear export of pre-microRNAs and short hairpin RNAs.
14631048 2004 Nuclear export of microRNA precursors.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14570900 2004 Minihelix-containing RNAs mediate exportin-5-dependent nuclear export of the double-stranded RNA-binding protein ILF3.
12702765 2003 Fas-associated death domain protein interacts with methyl-CpG binding domain protein 4: a potential link between genome surveillance and apoptosis.
12509441 2003 Exportin-5 mediates nuclear export of minihelix-containing RNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426393 2002 Exportin-5-mediated nuclear export of eukaryotic elongation factor 1A and tRNA.
12426392 2002 Exp5 exports eEF1A via tRNA from nuclei and synergizes with other transport pathways to confine translation to the cytoplasm.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11777942 2002 Exportin-5, a novel karyopherin, mediates nuclear export of double-stranded RNA binding proteins.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.