Property Summary

NCBI Gene PubMed Count 17
PubMed Score 39.64
PubTator Score 18.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.071 3.1e-02
medulloblastoma, large-cell 1.800 5.7e-05
limb girdle muscular dystrophy 2A -1.142 2.7e-04
group 3 medulloblastoma 1.600 2.6e-05
Pick disease -1.200 1.8e-06
progressive supranuclear palsy -1.100 7.9e-03

Gene RIF (8)

PMID Text
26293807 XPO4 copy number variation duplication was associated with histological severity of non-alcoholic fatty liver disease.
25911113 Knockdown of exportins 4, 5, and 7 altered thyroid hormone receptor shuttling dynamics, and when exportins 5 and 7 were overexpressed, TR distribution shifted toward the cytosol.
24597692 Methylation status of XPO4 in peripheral blood mononuclear cells (PBMCs) tended to be a noninvasive biomarker to predict hepatocellular carcinoma (HCC) and the progression of hepatitis B virus (HBV)infection.
22190034 HIV-1 Vpu is identified to have a physical interaction with exportin 4 (XPO4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21991335 These results demonstrate that Exp4 acts as a Sox9 co-regulator that directly regulates binding of Sox9 to its target genes.
21332550 Data suggest that XPO4 could be involved in the progression of human hepatocellular carcinoma.
19240061 Observational study of gene-disease association. (HuGE Navigator)
16449645 A short peptide representing the minimal interaction domain in Smad3 effectively competes with Smad3 association to exportin 4 and blocks nuclear export of Smad3 in vivo.

AA Sequence

MMAAALGPPEVIAQLENAAKVLMAPPSMVNNEQRQHAEHIFLSFRKSKSPFAVCKHILETSKVDYVLFQA      1 - 70
ATAIMEAVVREWILLEKGSIESLRTFLLTYVLQRPNLQKYVREQILLAVAVIVKRGSLDKSIDCKSIFHE     71 - 140
VSQLISSGNPTVQTLACSILTALLSEFSSSSKTSNIGLSMEFHGNCKRVFQEEDLRQIFMLTVEVLQEFS    141 - 210
RRENLNAQMSSVFQRYLALANQVLSWNFLPPNLGRHYIAMFESSQNVLLKPTESWRETLLDSRVMELFFT    211 - 280
VHRKIREDSDMAQDSLQCLAQLASLHGPIFPDEGSQVDYLAHFIEGLLNTINGIEIEDSEAVGISSIISN    281 - 350
LITVFPRNVLTAIPSELFSSFVNCLTHLTCSFGRSAALEEVLDKDDMVYMEAYDKLLESWLTLVQDDKHF    351 - 420
HKGFFTQHAVQVFNSYIQCHLAAPDGTRNLTANGVASREEEEISELQEDDRDQFSDQLASVGMLGRIAAE    421 - 490
HCIPLLTSLLEERVTRLHGQLQRHQQQLLASPGSSTVDNKMLDDLYEDIHWLILVTGYLLADDTQGETPL    491 - 560
IPPEIMEYSIKHSSEVDINTTLQILGSPGEKASSIPGYNRTDSVIRLLSAILRVSEVESRAIRADLTHLL    561 - 630
SPQMGKDIVWFLKRWAKTYLLVDEKLYDQISLPFSTAFGADTEGSQWIIGYLLQKVISNLSVWSSEQDLA    631 - 700
NDTVQLLVTLVERRERANLVIQCENWWNLAKQFASRSPPLNFLSSPVQRTLMKALVLGGFAHMDTETKQQ    701 - 770
YWTEVLQPLQQRFLRVINQENFQQMCQQEEVKQEITATLEALCGIAEATQIDNVAILFNFLMDFLTNCIG    771 - 840
LMEVYKNTPETVNLIIEVFVEVAHKQICYLGESKAMNLYEACLTLLQVYSKNNLGRQRIDVTAEEEQYQD    841 - 910
LLLIMELLTNLLSKEFIDFSDTDEVFRGHEPGQAANRSVSAADVVLYGVNLILPLMSQDLLKFPTLCNQY    911 - 980
YKLITFICEIFPEKIPQLPEDLFKSLMYSLELGMTSMSSEVCQLCLEALTPLAEQCAKAQETDSPLFLAT    981 - 1050
RHFLKLVFDMLVLQKHNTEMTTAAGEAFYTLVCLHQAEYSELVETLLSSQQDPVIYQRLADAFNKLTASS   1051 - 1120
TPPTLDRKQKMAFLKSLEEFMANVGGLLCVK                                          1121 - 1151
//

Text Mined References (25)

PMID Year Title
26293807 2015 Copy number variation in exportin-4 (XPO4) gene and its association with histological severity of non-alcoholic fatty liver disease.
25911113 2015 Multiple exportins influence thyroid hormone receptor localization.
24597692 2014 Exportin 4 gene expression and DNA promoter methylation status in chronic hepatitis B virus infection.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21991335 2011 Exportin 4 interacts with Sox9 through the HMG Box and inhibits the DNA binding of Sox9.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21332550 2011 Decreased expression of XPO4 is associated with poor prognosis in hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16449645 2006 The mechanism of nuclear export of Smad3 involves exportin 4 and Ran.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15282309 2004 Inhibition of nuclear import by the proapoptotic protein CC3.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10944119 2000 Exportin 4: a mediator of a novel nuclear export pathway in higher eukaryotes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.