Property Summary

NCBI Gene PubMed Count 302
PubMed Score 151.00
PubTator Score 399.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.400 8.8e-05

Gene RIF (295)

PMID Text
27468562 No association between XPC polymorphisms and grades/stages of tumors, but report significant association between XPC PAT and reduction of prostate cancer risk in this group of patients.
26811994 A novel role for the XPC protein in regulating APE1 and OGG1 expression and activity: XPC protein interacts physically with APE1 but not with OGG1.XPC is required for OGG1 activity.
26604426 XPC gene Lys939Gln polymorphism is significantly associated with increased risk of mitral chordae tendineae rupture.
26521083 XPC's function in DNA quality surveillance preventing sunlight-induced skin cancer is discussed. [review]
26384665 A tripartite lesion verification mechanism involving XPC, TFIIH, and XPA is necessary for efficient nucleotide excision repair.
26278556 Missense mutations in the XPC gene may allow partial functionality that could explain this unusual late onset XP. Atypical clinical presentation of XPC could be misdiagnosed when genetic aberrations allow partial DNA repair capacity.
26278177 Structural insight into the mechanism of TFIIH recognition by the acidic string of the nucleotide excision repair factor XPC has been uncovered.
26263968 the release of NER components such as DNA damage binding protein 2 (DDB2) and Xeroderma Pigmentosum complementation group C protein (XPC) following oxidative stress might putatively involve their apoptotic role rather than DNA repair function.
26227012 the present study demonstrates a novel mutation in the XPC gene that may be affecting mRNA synthesis with milder phenotypes.
26214629 Review/Meta-analysis: XPC polymorphisms were not risk factors for the development of colorectal cancer.
26213845 eIF3a improves ovarian cancer patients' response to cisplatin-based chemotherapy by down regulating XPC and p27(Kip1).
26170451 Data show that nucleotide excision repair factor XPC-RAD23B is a target of poly(ADP-ribosyl)ation catalyzed by poly(ADP-ribose) polymerase 1 (PARP1).
26151477 These data suggest that RNF111, together with the CRL4(DDB2) ubiquitin ligase complex, is responsible for sequential XPC ubiquitylation, which regulates the recruitment and release of XPC and is crucial for efficient progression of the NER reaction.
26042670 SUMOylation of xeroderma pigmentosum group C protein regulates DNA damage recognition during nucleotide excision repair
26001739 Single Nucleotide Polymorphism in XPC, XPD, XRCC1, and XRCC3 were associated with risk for head and neck squamous cell carcinomas.
25927440 Attenuated XPC protein expression levels are not associated with genome nucleotide excision repair activity in in bladder cancer.
25628365 DDB2 is protected by XPC from ubiquitination and degradation in a stochastic manner; thus XPC allows DDB2 to initiate multiple rounds of repair events, thereby contributing to the persistence of cellular DNA repair capacity
25566891 Testing of the XPC gene in two families with four xeroderma pigmentosum affected children led to the identification of the novel mutations c.1243C>T or p.R415X and c.1677C>A or p.Y559X.
25535740 XPF and XPC expression may be a potential predictive factor for bladder cancer, and smoking can not only influence the recurrence of bladder cancer as a single factor but also aggravate the results of the XPF defect and XPC defect.
25474887 XPC single nucleotide polymorphism and gene frequency in Russians, Tatars and Bashkirs.
25391773 Our results confirmed that polymorphisms in XPC and XPD may be associated with the risk of colorectal cancer.
25311495 Data show increased risk of leukemia with XPCC protein (XPC) 939Gln/Gln genotype, ERCC2 protein (XPD) 751Gln allele may be protective against chronic myeloid leukemia and acute myeloid leukemia, and no significant risk for the ERCC5 protein (XPG) gene.
25118285 findings uncovered an important role of USP7 in regulating NER via deubiquitinating XPC and by preventing its VCP/p97-regulated proteolysis.
24990617 The XPG rs17655 CC genotype is associated with shorter overall survival in gastric cancer.
24947936 This meta-analysis suggests that the XPC is a candidate gene for colorectal cancer susceptibility.
24886180 Review-Meta-analysis: XPC polymorphisms (Lys939Gln, Val499Arg, and PAT-/+) do not contribute to gastric cancer risk.
24770583 Chromatin retention of DNA damage sensors DDB2 and XPC through loss of p97 segregase causes genotoxicity.
24736739 we found that Gln939Gln genotype was associated with significantly increased risk of lung cancer in Asian population.
24607854 Among African Americans, there was a statistically significant positive association between colon cancer risk and XPC 499 AV+VV genotype.
24385304 This meta-analysis suggested that both the XPC Lys939Gln and Ala499Val polymorphisms were not risk factors for increasing colorectal cancer
24375193 meta-analysis suggests that XPC Lys939Gln polymorphism may contribute to lung cancer risk, which needs further validation in single larger studies
24338715 XPC Lys939Gln, few significant results were found in either the overall analysis or stratified analyses
24318982 Here, we show that hHR23A utilizes both the UBA2 and XPCB domains to form a stable complex with Vpr, linking Vpr directly to cellular DNA repair pathways and their probable exploitation by the virus.
24277375 Therefore, there is little evidence for the association between XPC Lys939Gln polymorphism and cutaneous melanoma risk.
24264314 found and reviewed nine case-control studies on CCND1 G870A with a total of 6,823 subjects and seven studies on XPC Ala499Val with a total of 7,674 subjects
24258024 XPC W690S pathogenic mutant is specifically defective for MDM2 binding and p53 degradation.
24093803 These analyses suggest that XPC gene PAT+/-polymorphism, but not rs2228001, likely contributes to susceptibility to PCa.
24051049 Results suggest XPC may act as a general sensor of damaged DNA that is capable of recognizing DNA containing lesions not repaired by Nucleotide Excision Repair.
23984341 The mutational spectrum of XP-C group seems to be homogeneous with some clusters of heterogeneity.
23892089 AN association between the XPC PAT +/+ genotype and cancer risk, especially for urinary system cancer. [Meta-analysis]
23830927 2 OGG1/XPC haplotypes are associated with younger age at onset independent of the number of CAG repeats in HTT. Both have XPC coding variants impacting protein function &/or variants in the 3'UTR altering protein levels by allele-specific mIR binding.
23819639 XPC Lys939Gln polymorphism contributed to the risk of urinary bladder cancer [review]
23803084 XPC genetic polymorphism is associated with the development of colorectal cancer.
23801864 The XPC Gln/Gln genotype alone and in combination with smoking increases the risk of colorectal neoplasms among Malaysians.
23776089 Polymorphism in XPC gene is associated with breast cancer.
23673479 Female carrying XPC and XRCC1 polymorphic genotypes had significantly increased risk of lung cancer.
23621265 XPC Lys939Gln polymorphism may correlate with clinical outcome of patients with epithelial ovarian cancer when treated with platinum-based chemotherapy in Northern China.
23604128 the data indicate that p53-dependent upregulation of XPC and DDB2 is a key mechanism upon genotoxic stress, whereby melanoma cells acquire resistance towards DNA cross-linking agents.
23422745 XPC is required for ATR and ATM recruitment to DNA damage site in UV irradiated cells.
23400628 meta-analysis investigating the associations of K939Q and A499V polymorphisms of XPC with cancer risk; overall, Lys939Gln was significantly associated with increased overall cancer risk; Ala499Val was also significantly associated with an increased overall cancer risk
23381646 XPC polymorphisms is associated with lung cancer susceptibility.
23269608 XPC Lys939Gln polymorphism is associated with bladder cancer.
23253478 Involvement of CSB and XPC in the repair of oxidative DNA lesions independent of the remainder of the nucleotide excision repair reaction.
23246108 XPC polymorphism gene was related to bladder cancer and to smoking status in bladder cancer patients, tumour stage, male gender and older age.
23244095 XPC 939A>C and 499C>T polymorphisms are not associated with skin cancer.
23143338 Report that the p.Val548AlafsX25 mutation is the major cause (76.19 %) of xeroderma pigmentosum in Moroccan families.
22968471 XPC polymorphisms are important markers for the outcome of patients with AML in the Chinese population.
22941172 XPC genetic polymorphism is associated with esophageal squamous cell carcinoma.
22902050 A susceptible association for Hodgkin lymphoma was observed on the XPC gene with haplotype CT
22682619 XPC-PolyAT polymorphisms are associated with a higher risk of developing prostate cancer.
22519360 Data suggest that xeroderma pigmentosum complementation group C (XPC) Ala499Val and Lys939Gln polymorphisms may increase risk for breast cancer (BC), and the polymorphisms were associated with the prognosis of BC patients.
22505326 the XPC-PAT variant genotype exhibits a significantly increased risk for bladder cancer
22431748 Recognition of DNA damage by XPC coincides with disruption of the XPC-RAD23 complex
22331493 Sodium arsenite +/- hyperthermia sensitizes wild-type p53-expressing EOC cells to cisplatin by suppressing DNA repair protein XPC.
22321329 XPA A23G and XPC C499T polymorphisms may contribute to the risk of developing acute lymphoblastic leukemia.
22213216 XPC Lys939Gln polymorphism might contribute to the identification of patients with increased risk for colorectal carcinoma
22211393 The mutation c.1643_1644delTG (p.Val548AlafsX25) represents alone 74% of all the XP probands tested and 87% in XP type C in North African patients with founder effect.
22174370 Findings suggest that XPC enhances DNA damage-induced apoptosis through inhibition of caspase-2 (casp-2S) transcription.
22166526 Polymorphisms of the XPC gene, Lys939Gln, may be a predictive marker of treatment response for advanced NSCLC patients in stage III.
22126485 Chromosome 3p22-p26 region harbor critical gene(s) including XPC associated with risk of laryngeal squamous cell carcinomas.
22038723 Our results suggested that the XPC protein is involved in the occurrence and progression of breast cancer.
21861227 Low-XPC mRNA may predict relapse in lung cancer patients who are never-smokers
21751198 Xeroderma pigmentosum complementation group C single-nucleotide polymorphisms in the nucleotide excision repair pathway is associated with advanced ovarian cancer.
21733660 European ancestry and XPC polymorphisms contribute to melanoma risk in a region exposed to high sun radiation
21689419 The two 3'UTR variants of XPC protein were associated with reduced protein and mRNA expression in plasmid-based assays, suggesting an effect on mRNA stability and/or transcription/translation.
21676658 xeroderma pigmentosum complementation group C is required for the fine tuning of CENTRIN 2 gene expression
21671483 The XPC Lys939Gln polymorphism may modulate breast cancer susceptibility jointly with the menopausal status.
21559836 The XPC C/A (i11) genotype is associated with an increased risk of sporadic colorectal cancer.
21482201 the first skin cancer appeared at a median age of 4.5 years with no neurological symptoms. Post-UV DNA repair, cell survival and genetic complementation assigned these patients to the XP group C
21426550 The mutated homozygous genotype for XPC gene was associated with increased risk of developing bladder cancer.
21390502 Association between OGG1 Ser326Cys, XPC Lys939Gln, XPD Lys751Gln polymorphisms and the susceptibility tho cancer and the oxidative stress status were evaluated.
21338203 Single nucleotide polymorphisms in XPC intron 9 is associated with specific ethnicity.
21327329 Our results suggest that XPC expression predicts drug resistance in LADC.
21273643 During a mutation screen of XPC in DNA from 33 bladder tumour samples and matched blood samples, we identified five novel variants in the patients' germ line DNA.
21192964 Xeroderma pigmentosum complementation group C (XPC) plays an essential role in the nucleotide excision repair of zidovudine-induced DNA damage in hepatoma cells.
21167810 Knockdown of XPC (XPC(KD)) in normal human keratinocytes results in metabolism remodeling through NADPH oxidase-1 (NOX-1) activation, which in turn leads to increased ROS levels.
21149730 Data show that inhibition of the deacetylase and longevity factor SIRT1 impairs global genome NER through suppressing the transcription of XPC in a SIRT1 deacetylase-dependent manner.
21123941 genomic instability resulting from XPC silencing results in activation of AKT1 and subsequently NOX1 to induce ROS generation, mtDNA deletions, and neoplastic transformation in keratinocytes
21113018 XPC exonic variants contributed to the risk of gallbladder cancer (GBC) in this Chinese population.
21104992 XPC gene polymorphisms is associated with colorectal cancer.
21047201 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20887739 analysis of three XPC polymorphisms in urinary-bladder cancer patients
20887739 Observational study of gene-disease association. (HuGE Navigator)
20817763 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20731661 Findings suggest that PARP1, XRCC1, MGMT, XPC, XPD and MSH2 SNP can be used as prognostic markers for patients with surgically resected early stage NSCLC.
20731661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20658464 results suggest that the XPC codon 939 polymorphism may be associated with the risk and outcome of AFB1-related hepatocellular carcinoma in the Guangxi population and may interact with AFB1 exposure in the process of HCC induction by AFB1.
20658464 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20649465 Results describe a dynamic interplay between XPC protein and DNA, whereby the association with one displaced nucleotide in the undamaged strand mediates the initial encounter with lesion sites.
20649433 The carriers of the variant genotype of OGG1, XPC, or XPD, did not associate with the increased risk of cancer progression, despite the increased oxidative stress in cancer patients.
20616346 Data suggest that loss or mutation of XPC may be an early event during skin carcinogenesis that provides a selective advantage for initiation and progression of squamous cell carcinomas in non XP-C patients.
20601096 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20575039 analysis of SNPs on the nucleotide excision repair genes performed in 92 chronic phase CML patients treated with imatinib showed XPC SNPs correlated with the response to imatinib.
20575039 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20571354 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20488473 Epigenetic defects in the XPC gene impact bladder cancer malignant behavior and may also predict poor outcome in some bladder cancer cases, as characterized by p53 pathway alteration.
20460046 XPC and XPG polymorphisms do not independently affect the susceptibility to hepatocellular carcinoma, but the joint effect of C allele of XPC Lys939Gln and female sex may modify the risk.
20460046 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20429839 Observational study of gene-disease association. (HuGE Navigator)
20391138 Observational study of gene-disease association. (HuGE Navigator)
20377134 Polymorphisms and haplotypes in XPC is associated with cervical cancer.
20377134 Observational study of gene-disease association. (HuGE Navigator)
20369554 The Ala499Val (C > T) polymorphism of the XPC gene is correlated with male infertility and may be a potential genetic risk factor for male infertility in the Chinese Han population.
20369554 Observational study of gene-disease association. (HuGE Navigator)
20368362 Data show that XPC and Ku oppositely regulate the ubiquitin ligase activity of DDB2, and that DDB2 complex-mediated ubiquitylation plays a role in recruiting XPA to damaged sites.
20232359 The results implied that genetic polymorphisms in DNA repair genes XPC and XRCC4 might alter the normal protein function and be independent risk factors for progression of gastric antrum adenocarcinoma.
20232359 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20199546 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20193233 Among people infected by HCV, the mutant gene of Ala499Val had the tendency to lower the risk of primary hepatocellular carcinoma
20193233 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20157331 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20150366 Observational study of gene-disease association. (HuGE Navigator)
20106949 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20061190 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20056640 genetic variations in XPA and XPC genes may modulate DNA damage levels when exposed to polycyclic aromatic hydrocarbons
20054342 As the (p.Val548AlafsX25) XPC mutation is responsible for a huge proportion of xeroderma pigmentosum cases, our data imply an obvious simplification of XP molecular diagnosis, at least in North Africa.
19953607 Mutations in XPC branch-point sequences (BPS) resulted in disruption of U2 snRNP-BPS interaction leading to abnormal pre-mRNA splicing and reduced XPC protein.
19924443 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19902366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19892827 the 5'-GTG-3' sequence, containing 5R thymine glycol, paired with adenine, is a good binding substrate for XPA and XPC/HR23B.
19878615 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19706757 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19661089 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19609301 These studies reveal a two-stage discrimination process, whereby XPC protein first deploys a dynamic sensor interface to rapidly interrogate the DNA double helix,before the final installation of a more static repair-initiating complex.
19538122 XPC subunit interaction with DNA is stimulated by endogenous HR23B.
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19478817 The clinical and genetic investigation of XP-C patients in 14 Tunisian families, is reported.
19434073 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19350405 Polymorphism in XPC Lys939Gln may modulate superficial bladder cancer risk.
19350405 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19280628 These data suggest that genetic polymorphisms in DNA repair genes may modify the risk of HD, especially when interactions between the pathways are considered.
19280628 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19270000 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19177501 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19124519 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19027756 In a group of elderly people those who were homozygous with C/C or A/A in XPC IVS11 had more aberrant cells compared with C/A heterozygotes (P=0.04).
19027756 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18955168 XPC initiation codon mutation in xeroderma pigmentosum patients with and without neurological symptoms
18854777 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18838045 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18830263 Observational study of gene-disease association. (HuGE Navigator)
18809580 biochemical properties behind XPC mutations found within three xeroderma pigmentosum patients
18785488 Study did not find a direct correlation of polymorphisms in xeroderma pigmentosum group C to the risk of ovarian carcinoma
18785488 Observational study of gene-disease association. (HuGE Navigator)
18774935 Data show that XPC, XPA, and RPA demonstrate low specificity in binding to damaged DNA compared with undamaged DNA duplexes.
18771913 This meta-analysis found an increased overall cancer risk for variant homozygotes of Lys(939)Gln (OR=1.16, 95% CI, 1.05-1.28) and Ala(499)Val (OR=1.24, 95% CI, 1.08-1.42) compared with their corresponding wild-type homozygotes.
18771913 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
18709642 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18701435 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18682493 Photobleaching experiments showed that XPC constantly associates with and dissociates from chromatin in the absence of DNA damage.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18645534 XPA A23G and XPC exon 8 Val499Ala polymorphisms may be useful markers for identifying individuals at risk of developing gastric cardiac adenocarcinoma in the high incidence region of north China
18645534 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18630471 Observational study of gene-disease association. (HuGE Navigator)
18574675 Fluorescence correlation spectroscopy of the binding of nucleotide excision repair protein XPC-HHRB23B with DNA substrates is reported.
18559563 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18544627 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18478970 Observational study of genotype prevalence. (HuGE Navigator)
18320070 Observational study of gene-disease association. (HuGE Navigator)
18285822 XPC is a good candidate for large-scale epidemiological case-control studies that may lead to improvement in the management of highly prevalent cancers
18285822 Meta-analysis of gene-disease association. (HuGE Navigator)
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18196582 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18177054 NMR analysis indicates that the physical interaction between C-XPC and centrin 2 induces only minor conformational changes into XPC, localized around the 17-mer segment (847-863), showed to be critically involved in the centrin binding.
18097734 A meta-analysis of association between XPC polymorphisms and cancer risk.
18097734 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18089819 p53 determines the switch by regulating xpc and DNA double-strand breaks in antineoplastic agent treatment of glioblastoma multiforme.
18067564 XPC Ala499Val (C>T) polymorphism is correlated with high risk of idiopathic azoospermia in the Han-Chinese population.
18067564 Observational study of gene-disease association. (HuGE Navigator)
18053706 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18035379 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17932354 Observational study of gene-disease association. (HuGE Navigator)
17923445 The DNA repair capacities of host cells might be modulated by specific XPC polymorphisms.
17923445 Observational study of gene-disease association. (HuGE Navigator)
17913280 41% higher risk for lung canser among carries of the XPC Lys939Glncc genotype compared with the XPC Lsy939Glncc genotype.
17913280 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17897675 Data show that overexpression of XPC perturbs the cellular distribution of HsCen2, by inducing a translocation of centrin molecules from the cytoplasm to the nucleus.
17882560 The XPC 499Val allele and its haplotype were strongly associated with nasopharyngeal carcinoma. This polymorphism may be a contributing factor in NPC development.
17882560 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17825393 Observational study of gene-disease association. (HuGE Navigator)
17712032 Observational study of gene-disease association. (HuGE Navigator)
17705814 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17685459 Observational study of gene-disease association. (HuGE Navigator)
17684138 Observational study of gene-disease association. (HuGE Navigator)
17684138 Only carriers of the XPC 499Val/Val genotype had a significantly increased SCCHN risk.
17682058 Results demonstrate the role of DNA binding by xeroderma pigmentosum C protein in the assembly of subsequent nucleotide excision repair intermediate complexes.
17657713 predictive value of DNA damage-induced XPC levels as a possible biomarker for radiosensitivity has to be further investigated
17653764 Single nucleotide polymorphisms of xeroderma pigmentosum group C is associated with esophageal squamous cell carcinoma
17653764 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17575242 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17531525 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17508409 Results suggest that reduced XPC mRNA level may constitute an independent prognostic factor for nonsmall cell lung cancer patients.
17498315 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17498315 results suggest that inherited sequence variations in XPC may modulate risk of lung cancer, especially lung adenocarcinoma, in Chinese populations
17438703 XPC (K939Q) polymorphism either individually or in combination with the XPD (K751Q) polymorphism modulates the risk of death in patients with urinary bladder neoplasms
17374967 Observational study of gene-disease association. (HuGE Navigator)
17374967 XPC polymorphism might affect p53 alteration and the molecular pathway defined by the p53 alteration in the development of muscle-invasive bladder cancer
17363013 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17363013 statistically significant interaction between the XPC Lys939Gln polymorphism and consumption of red meat, with a 3.7-fold increase in colorectal cancer risk per 100g red meat intake per day among carriers of the homozygous variant
17325666 Results show that hypermethylation of the XPC promoter may play a crucial role in XPC inactivation, which may partly contribute to the occurrence of p53 mutations during lung tumorigenesis, especially nonsmokers.
17196815 Observational study of gene-disease association. (HuGE Navigator)
17164382 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17164380 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17119055 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17086695 Observational study of gene-disease association. (HuGE Navigator)
17078101 Observational study of gene-disease association. (HuGE Navigator)
17052994 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17052994 sequence variants in the XPC gene may modulate the risk of bladder cancer.
16985021 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16965652 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16965652 In the high incidence region of Hebei Province, C/T genotype of XPC exon 8 may decrease the risk of developing gastsric cardiac adenocarcinoma.
16957781 XPC plays an unexpected and multifaceted role in cell protection from oxidative DNA damage.
16858626 This article summarizes our current knowledge of the properties of the XPC complex and UV-DDB and discusses possible roles for ubiquitylation in the molecular mechanisms that underlie the efficient recognition and repair of DNA damage.
16823510 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16820684 A complex formed by a Ca2+-bound human centrin 2 with a 17-mer peptide derived from the XPC sequence was crystallized.
16794584 A novel homozygous complex insertion/deletion mutation within exon 9 of the XPC gene in Iraqi family with xeroderma pigmentosum was reproted.
16627479 the crystal structure of calcium-loaded full-length centrin-2 complexed with a xeroderma pigmentosum group C peptide; a novel binding motif for centrin
16571649 Observational study of gene-disease association. (HuGE Navigator)
16537713 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16527807 CUL-4A mediates the proteolytic degradation of DDB2 and this degradation event, initiated at the lesion sites, regulates damage recognition by XPC.
16510122 Observational study of gene-disease association. (HuGE Navigator)
16492920 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16492920 Three linked XPC alleles, 492R, 499A, and 939Q, were associated with increased risk of colorectal adenoma in smokers.
16399771 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16393248 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16373199 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16351803 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16284373 Observational study of gene-disease association. (HuGE Navigator)
16258177 Observational study of gene-disease association. (HuGE Navigator)
16105547 RAD23 homolog A regulates the function of XPC by its association with the nucleotide excision repair activator p53
16086280 The findings support the hypothesis that these two XPC variants may contribute to the risk of developing lung cancer.
16086280 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16081512 Reduced XPC mRNA levels and mutations are associated with xeroderma pigmentosum risk
16061005 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16043197 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16002061 Observational study of gene-disease association. (HuGE Navigator)
15992842 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15964821 Centrin 2 stimulates nucleotide excision repair by interacting with XPC.
15922480 Overexpression of XPC is associated with liver fibrogenesis and cancer and could be related to the well recognized resistance of HCC to chemotherapeutics.
15914210 Observational study of gene-disease association. (HuGE Navigator)
15886698 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15882621 XPC undergoes reversible ubiquitylation upon UV irradiation and this depends on the presence of functional UV-DDB activity.
15878910 Observational study of gene-disease association. (HuGE Navigator)
15863269 Observational study of gene-disease association. (HuGE Navigator)
15849729 Observational study of gene-disease association. (HuGE Navigator)
15837542 Observational study of gene-disease association. (HuGE Navigator)
15746160 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15731165 Observational study of gene-disease association. (HuGE Navigator)
15729698 Observational study of gene-disease association. (HuGE Navigator)
15700316 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15700316 Genetic polymorphism in XPC gene is associated with lung cancer
15661662 presence of nucleosomes in undamaged DNA regions may help specific binding of the XPC complex to damaged sites by excluding its non-specific binding to undamaged DNA regions
15657918 Observational study of gene-disease association. (HuGE Navigator)
15533908 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15494739 Observational study of gene-disease association. (HuGE Navigator)
15471894 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15353127 XPC protein plays an important role in the cisplatin treatment-mediated cellular response and may suggest a possible mechanism of cancer cell drug resistance.
15107491 important role of the XPC protein in the cancer prevention
15010895 Observational study of gene-disease association. (HuGE Navigator)
14729591 Observational study of gene-disease association. (HuGE Navigator)
14690560 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14688016 Observational study of gene-disease association. (HuGE Navigator)
12944386 DDB2p48 activates the recruitment of XPC to cyclobutane pyrimidine dimers and may be the initial recognition factor in the nucleotide excision repair pathway
12890685 Analysis of the XPC sequence (940 residues), using a calmodulin target recognition software, enabled us to predict two putative binding sites for centrin-2
12815074 analysis of mHR23A/B double-mutant cells showed that HR23 proteins function in nucleotide excision repair by governing xeroderma pigmentosum group C protein stability via partial protection against proteasomal degradation
12713809 XPC and TFIIH are recruited to DNA damage by TP53
12505994 interacts physically and functionally with thymine DNA glycosylase
12496474 BRCA1 upregulates XPC, with some evidence that p53 is involved in its regulation.
12486030 the multistep process of DNA damage recognition includes initiation by XPC-hHR23B, which is then replaced by the combined action of XPA and RPA
12242345 XPC is regulated by DNA damage and p53
12177305 human XPC DNA repair gene: arrangement, splice site information content and influence of a single nucleotide polymorphism in a splice acceptor site on alternative splicing and function
11872635 Observational study of gene-disease association. (HuGE Navigator)
11872635 we investigated the association between the repair phenotype of ultraviolet (UV)-induced damage and genotypes of three DNA repair genes, XPC and XPD [involved in nucleotide excision repair (NER)] and XRCC1 [involved in base excision repair (BER)].

AA Sequence

MARKRAAGGEPRGRELRSQKSKAKSKARREEEEEDAFEDEKPPKKSLLSKVSQGKRKRGCSHPGGSADGP      1 - 70
AKKKVAKVTVKSENLKVIKDEALSDGDDLRDFPSDLKKAHHLKRGATMNEDSNEEEEESENDWEEVEELS     71 - 140
EPVLGDVRESTAFSRSLLPVKPVEIEIETPEQAKTRERSEKIKLEFETYLRRAMKRFNKGVHEDTHKVHL    141 - 210
LCLLANGFYRNNICSQPDLHAIGLSIIPARFTRVLPRDVDTYYLSNLVKWFIGTFTVNAELSASEQDNLQ    211 - 280
TTLERRFAIYSARDDEELVHIFLLILRALQLLTRLVLSLQPIPLKSATAKGKKPSKERLTADPGGSSETS    281 - 350
SQVLENHTKPKTSKGTKQEETFAKGTCRPSAKGKRNKGGRKKRSKPSSSEEDEGPGDKQEKATQRRPHGR    351 - 420
ERRVASRVSYKEESGSDEAGSGSDFELSSGEASDPSDEDSEPGPPKQRKAPAPQRTKAGSKSASRTHRGS    421 - 490
HRKDPSLPAASSSSSSSKRGKKMCSDGEKAEKRSIAGIDQWLEVFCEQEEKWVCVDCVHGVVGQPLTCYK    491 - 560
YATKPMTYVVGIDSDGWVRDVTQRYDPVWMTVTRKCRVDAEWWAETLRPYQSPFMDREKKEDLEFQAKHM    561 - 630
DQPLPTAIGLYKNHPLYALKRHLLKYEAIYPETAAILGYCRGEAVYSRDCVHTLHSRDTWLKKARVVRLG    631 - 700
EVPYKMVKGFSNRARKARLAEPQLREENDLGLFGYWQTEEYQPPVAVDGKVPRNEFGNVYLFLPSMMPIG    701 - 770
CVQLNLPNLHRVARKLDIDCVQAITGFDFHGGYSHPVTDGYIVCEEFKDVLLTAWENEQAVIERKEKEKK    771 - 840
EKRALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARILAASWPQNRED    841 - 910
EEKQKLKGGPKKTKREKKAAASHLFPFEQL                                            911 - 940
//

Text Mined References (322)

PMID Year Title
27468562 2016 Association of XPC Gene Polymorphisms with Prostate Cancer Risk.
26811994 XPC deficiency is related to APE1 and OGG1 expression and function.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26604426 2015 DNA Repair Gene Polymorphism and the Risk of Mitral Chordae Tendineae Rupture.
26521083 2016 Xeroderma pigmentosum group C sensor: unprecedented recognition strategy and tight spatiotemporal regulation.
26384665 2015 Tripartite DNA Lesion Recognition and Verification by XPC, TFIIH, and XPA in Nucleotide Excision Repair.
26278556 2015 Atypical Clinical Presentation of Xeroderma Pigmentosum in a Patient Harboring a Novel Missense Mutation in the XPC Gene: The Importance of Clinical Suspicion.
26278177 2015 Structural Insight into the Mechanism of TFIIH Recognition by the Acidic String of the Nucleotide Excision Repair Factor XPC.
26263968 2015 Combination of A? Secretion and Oxidative Stress in an Alzheimer-Like Cell Line Leads to the Over-Expression of the Nucleotide Excision Repair Proteins DDB2 and XPC.
26227012 2015 Novel mutation in the XPC gene: a case report of a patient with xeroderma pigmentosum.
26214629 Lack of associations between XPC polymorphisms and colorectal cancer: a meta-analysis.
26213845 2015 eIF3a improve cisplatin sensitivity in ovarian cancer by regulating XPC and p27Kip1 translation.
26170451 2015 Poly(ADP-ribose) Polymerase 1 Modulates Interaction of the Nucleotide Excision Repair Factor XPC-RAD23B with DNA via Poly(ADP-ribosyl)ation.
26151477 2015 SUMO and ubiquitin-dependent XPC exchange drives nucleotide excision repair.
26042670 2015 SUMOylation of xeroderma pigmentosum group C protein regulates DNA damage recognition during nucleotide excision repair.
26001739 2015 DNA repair genes XPC, XPD, XRCC1, and XRCC3 are associated with risk and survival of squamous cell carcinoma of the head and neck.
25927440 2015 Attenuated XPC expression is not associated with impaired DNA repair in bladder cancer.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25628365 2015 Functional regulation of the DNA damage-recognition factor DDB2 by ubiquitination and interaction with xeroderma pigmentosum group C protein.
25566891 Clinical profile and mutation analysis of xeroderma pigmentosum in Indian patients.
25535740 2014 Attenuated NER expressions of XPF and XPC associated with smoking are involved in the recurrence of bladder cancer.
25474887 2013 [Polymorphism of DNA repair genes (XRCC1, XRCC3, XPC, XPD, XPA) in ethnic groups from Republic of Bashkortostan].
25391773 2015 Polymorphisms in nucleotide excision repair genes and susceptibility to colorectal cancer in the Polish population.
25311495 2015 Polymorphisms in XPC, XPD and XPG DNA repair genes and leukemia risk in a Tunisian population.
25118285 2014 Ubiquitin-specific protease 7 regulates nucleotide excision repair through deubiquitinating XPC protein and preventing XPC protein from undergoing ultraviolet light-induced and VCP/p97 protein-regulated proteolysis.
24990617 2014 Potentially functional variants in the core nucleotide excision repair genes predict survival in Japanese gastric cancer patients.
24947936 2014 XPC Lys939Gln polymorphism contributes to colorectal cancer susceptibility: evidence from a meta-analysis.
24886180 2014 Current evidences on XPC polymorphisms and gastric cancer susceptibility: a meta-analysis.
24770583 2014 Chromatin retention of DNA damage sensors DDB2 and XPC through loss of p97 segregase causes genotoxicity.
24736739 2014 Association of XPC polymorphisms and lung cancer risk: a meta-analysis.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24607854 2014 Nucleotide excision repair gene polymorphisms, meat intake and colon cancer risk.
24385304 2014 XPC Lys939Gln and Ala499Val polymorphisms in colorectal cancer susceptibility: a meta-analysis of case-control studies.
24375193 2014 Associations between polymorphisms of the XPC gene and lung cancer susceptibility: a meta-analysis.
24338715 2014 Polymorphisms of the XPC gene may contribute to the risk of head and neck cancer: a meta-analysis.
24318982 2014 Binding of HIV-1 Vpr protein to the human homolog of the yeast DNA repair protein RAD23 (hHR23A) requires its xeroderma pigmentosum complementation group C binding (XPCB) domain as well as the ubiquitin-associated 2 (UBA2) domain.
24277375 2014 Quantitative assessment of the association between XPC Lys939Gln polymorphism and cutaneous melanoma risk.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24264314 2014 Association between CCND1 and XPC polymorphisms and bladder cancer risk: a meta-analysis based on 15 case-control studies.
24258024 2014 XPC promotes MDM2-mediated degradation of the p53 tumor suppressor.
24093803 2013 Association of XPC gene polymorphisms with susceptibility to prostate cancer: evidence from 3,936 subjects.
24051049 2013 Xeroderma pigmentosum complementation group C protein (XPC) serves as a general sensor of damaged DNA.
23984341 2013 Further evidence of mutational heterogeneity of the XPC gene in Tunisian families: a spectrum of private and ethnic specific mutations.
23892089 2013 Poly (AT) deletion/insertion polymorphism of the XPC gene contributes to urinary system cancer susceptibility: a meta-analysis.
23830927 2013 The impact of single-nucleotide polymorphisms (SNPs) in OGG1 and XPC on the age at onset of Huntington disease.
23819639 2013 The association between XPC Lys939Gln gene polymorphism and urinary bladder cancer susceptibility: a systematic review and meta-analysis.
23803084 2013 Associations of ABCB1 and XPC genetic polymorphisms with susceptibility to colorectal cancer and therapeutic prognosis in a Chinese population.
23801864 2013 XPC Lys939Gln polymorphism, smoking and risk of sporadic colorectal cancer among Malaysians.
23776089 2013 Genetic polymorphisms in RAD23B and XPC modulate DNA repair capacity and breast cancer risk in Puerto Rican women.
23673479 2013 DNA repair genes polymorphism and lung cancer risk with the emphasis to sex differences.
23621265 2013 DNA repair gene associated with clinical outcome of epithelial ovarian cancer treated with platinum-based chemotherapy.
23604128 2014 Malignant melanoma cells acquire resistance to DNA interstrand cross-linking chemotherapeutics by p53-triggered upregulation of DDB2/XPC-mediated DNA repair.
23422745 2013 NER initiation factors, DDB2 and XPC, regulate UV radiation response by recruiting ATR and ATM kinases to DNA damage sites.
23400628 2013 Associations of Lys939Gln and Ala499Val polymorphisms of the XPC gene with cancer susceptibility: a meta-analysis.
23381646 2013 A meta-analysis of evidences on XPC polymorphisms and lung cancer susceptibility.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23269608 2013 An association between XPC Lys939Gln polymorphism and the risk of bladder cancer: a meta-analysis.
23253478 2012 Nucleotide excision repair-initiating proteins bind to oxidative DNA lesions in vivo.
23246108 2013 Study on bladder cancer susceptibility and genetic polymorphisms of XPC, XPG, and CYP in smokers and non-smokers.
23244095 2012 XPC 939A>C and 499C>T polymorphisms and skin cancer risk: a meta-analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23143338 2013 c.1643_1644delTG XPC mutation is more frequent in Moroccan patients with xeroderma pigmentosum.
22968471 2012 Polymorphisms in XPC provide prognostic information in acute myeloid leukemia.
22941172 2013 The survival impact of XPA and XPC genetic polymorphisms on patients with esophageal squamous cell carcinoma.
22902050 2012 Using haplotype analysis to elucidate significant associations between genes and Hodgkin lymphoma.
22682619 2012 Poly (AT) polymorphism in the XPC gene and smoking enhance the risk of prostate cancer in a low-risk Chinese population.
22519360 2012 Association of XPC polymorphisms with susceptibility and clinical outcome to chemotherapy in breast cancer patients.
22505326 2012 Interactions between cigarette smoking and XPC-PAT genetic polymorphism enhance bladder cancer risk.
22431748 2012 Recognition of DNA damage by XPC coincides with disruption of the XPC-RAD23 complex.
22331493 2012 Sodium arsenite ± hyperthermia sensitizes p53-expressing human ovarian cancer cells to cisplatin by modulating platinum-DNA damage responses.
22321329 2011 [The relationship between polymorphism of genes XPA, XPC, XPD, XRCC1 and susceptibility to acute lymphoblastic leukemia].
22213216 2012 DNA repair genes XPC, XPG polymorphisms: relation to the risk of colorectal carcinoma and therapeutic outcome with Oxaliplatin-based adjuvant chemotherapy.
22211393 2012 Carrier frequency of the recurrent mutation c.1643_1644delTG in the XPC gene and birth prevalence of the xeroderma pigmentosum in Morocco.
22174370 2012 Nucleotide excision repair factor XPC enhances DNA damage-induced apoptosis by downregulating the antiapoptotic short isoform of caspase-2.
22166526 2010 XPC Lys939Gln polymorphism is associated with the decreased response to platinum based chemotherapy in advanced non-small-cell lung cancer.
22126485 2011 Genome-wide evidence of XPC alteration in laryngeal squamous cell carcinomas.
22038723 2012 Clinicopathological significance and prognostic value of Xeroderma pigmentosum complementary group C (XPC) expression in sporadic breast cancer patients.
21962512 2011 A DNA repair complex functions as an Oct4/Sox2 coactivator in embryonic stem cells.
21861227 2012 XPC mRNA level may predict relapse in never-smokers with non-small cell lung cancers.
21751198 2012 Xeroderma pigmentosum complementation group C single-nucleotide polymorphisms in the nucleotide excision repair pathway correlate with prolonged progression-free survival in advanced ovarian cancer.
21733660 2011 European ancestry and polymorphisms in DNA repair genes modify the risk of melanoma: a case-control study in a high UV index region in Brazil.
21689419 2011 Functional assays to determine the significance of two common XPC 3'UTR variants found in bladder cancer patients.
21676658 2011 Differential contribution of XPC, RAD23A, RAD23B and CENTRIN 2 to the UV-response in human cells.
21671483 2011 [Association of XPC gene polymorphisms with breast cancer risk].
21559836 2012 The C/A polymorphism in intron 11 of the XPC gene plays a crucial role in the modulation of an individual's susceptibility to sporadic colorectal cancer.
21482201 2011 A new XPC gene splicing mutation has lead to the highest worldwide prevalence of xeroderma pigmentosum in black Mahori patients.
21426550 2011 The effect of tobacco, XPC, ERCC2 and ERCC5 genetic variants in bladder cancer development.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21390502 2011 DNA repair enzyme polymorphisms and oxidative stress in a Turkish population with gastric carcinoma.
21338203 2010 NER and BER repair gene polymorphisms in a healthy north Indian cohort and comparison with different ethnic groups worldwide.
21327329 2011 Expression of xeroderma pigmentosum complementation group C protein predicts cisplatin resistance in lung adenocarcinoma patients.
21273643 2011 In vitro functional effects of XPC gene rare variants from bladder cancer patients.
21192964 2011 XPC is essential for nucleotide excision repair of zidovudine-induced DNA damage in human hepatoma cells.
21167810 2011 XPC silencing in normal human keratinocytes triggers metabolic alterations through NOX-1 activation-mediated reactive oxygen species.
21149730 2010 Regulation of global genome nucleotide excision repair by SIRT1 through xeroderma pigmentosum C.
21123941 2011 XPC silencing in normal human keratinocytes triggers metabolic alterations that drive the formation of squamous cell carcinomas.
21113018 2011 Ala499Val (C>T) and Lys939Gln (A>C) polymorphisms of the XPC gene: their correlation with the risk of primary gallbladder adenocarcinoma--a case-control study in China.
21104992 2011 The association of XPC polymorphisms and tea drinking with colorectal cancer risk in a Chinese population.
21047201 2010 Nucleotide excision repair gene polymorphisms may predict acute toxicity in patients treated with chemoradiotherapy for bladder cancer.
20887739 2010 Genotypes, haplotypes and diplotypes of three XPC polymorphisms in urinary-bladder cancer patients.
20817763 2010 Polymorphic DNA repair and metabolic genes: a multigenic study on gastric cancer.
20798892 2010 Stimulation of DNA Glycosylase Activities by XPC Protein Complex: Roles of Protein-Protein Interactions.
20731661 2010 Comprehensive analysis of DNA repair gene polymorphisms and survival in patients with early stage non-small-cell lung cancer.
20658464 2010 Polymorphism in xeroderma pigmentosum complementation group C codon 939 and aflatoxin B1-related hepatocellular carcinoma in the Guangxi population.
20649465 2011 Dissection of the xeroderma pigmentosum group C protein function by site-directed mutagenesis.
20649433 2010 Oxidative stress, Helicobacter pylori, and OGG1 Ser326Cys, XPC Lys939Gln, and XPD Lys751Gln polymorphisms in a Turkish population with colorectal carcinoma.
20616346 2010 The DNA damage-binding protein XPC is a frequent target for inactivation in squamous cell carcinomas.
20601096 2010 Single-nucleotide polymorphisms in DNA-repair genes and cutaneous melanoma.
20575039 2010 XPC genetic polymorphisms correlate with the response to imatinib treatment in patients with chronic phase chronic myeloid leukemia.
20571354 2010 XPC gene intron 11 C/A polymorphism is a predictive biomarker for the sensitivity to NP chemotherapy in patients with non-small cell lung cancer.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20488473 2010 XPC epigenetic silence coupled with p53 alteration has a significant impact on bladder cancer outcome.
20460046 2010 [Association of XPC and XPG polymorphisms with the risk of hepatocellular carcinoma].
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20429839 2010 Polymorphisms in DNA damage response genes and head and neck cancer risk.
20391138 2010 Lifestyle, environmental, and genetic predictors of bulky DNA adducts in a study population nested within a prospective Danish cohort.
20377134 2010 Genetic variants of DNA repair gene XPC modulating susceptibility to cervical cancer in North India.
20369554 2010 [Ala499Val (C > T) and Lys939Gln (A > C) polymorphisms of the XPC gene: their correlation with male infertility].
20368362 2010 DDB2 complex-mediated ubiquitylation around DNA damage is oppositely regulated by XPC and Ku and contributes to the recruitment of XPA.
20232359 2010 Genetic polymorphisms in DNA repair genes XPC, XPD, and XRCC4, and susceptibility to Helicobacter pylori infection-related gastric antrum adenocarcinoma in Guangxi population, China.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20199546 2010 Interactions between ultraviolet light exposure and DNA repair gene polymorphisms may increase melanoma risk.
20193233 2009 [A 1:1 matched case-control study on the interaction between HBV, HCV infection and DNA repair gene XPC Ala499Val, Lys939Gln for primary hepatocellular carcinoma].
20157331 2010 SNPs in genes coding for ROS metabolism and signalling in association with docetaxel clearance.
20150366 2010 DNA repair gene polymorphisms and risk of adult meningioma, glioma, and acoustic neuroma.
20106949 2010 A comprehensive haplotype analysis of the XPC genomic sequence reveals a cluster of genetic variants associated with sensitivity to tobacco-smoke mutagens.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20061190 2010 ERCC1 haplotypes modify bladder cancer risk: a case-control study.
20056640 2010 Genetic variants of nucleotide excision repair genes are associated with DNA damage in coke oven workers.
20054342 2010 A prevalent mutation with founder effect in xeroderma pigmentosum group C from north Africa.
20028083 2010 Photo-cross-linking of XPC-Rad23B to cisplatin-damaged DNA reveals contacts with both strands of the DNA duplex and spans the DNA adduct.
19953607 2010 XPC branch-point sequence mutations disrupt U2 snRNP binding, resulting in abnormal pre-mRNA splicing in xeroderma pigmentosum patients.
19941824 2009 Two-step recognition of DNA damage for mammalian nucleotide excision repair: Directional binding of the XPC complex and DNA strand scanning.
19924443 2010 XPC gene variants: a risk factor for recurrence of urothelial bladder carcinoma in patients on BCG immunotherapy.
19902366 2010 Genetic variation in DNA repair genes and prostate cancer risk: results from a population-based study.
19892827 2010 Binding of the human nucleotide excision repair proteins XPA and XPC/HR23B to the 5R-thymine glycol lesion and structure of the cis-(5R,6S) thymine glycol epimer in the 5'-GTgG-3' sequence: destabilization of two base pairs at the lesion site.
19878615 2010 Modulation of nucleotide excision repair in human lymphocytes by genetic and dietary factors.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19714462 2010 Genetic variation in genes interacting with BRCA1/2 and risk of breast cancer in the Cypriot population.
19706757 2009 Polymorphisms in DNA repair genes, smoking, and bladder cancer risk: findings from the international consortium of bladder cancer.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19661089 2009 Genetic variation in immune regulation and DNA repair pathways and stomach cancer in China.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19609301 2009 Two-stage dynamic DNA quality check by xeroderma pigmentosum group C protein.
19538122 2009 Photoactivated DNA analogs of substrates of the nucleotide excision repair system and their interaction with proteins of NER-competent HeLa cell extract.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19478817 2009 High frequency of the V548A fs X572 XPC mutation in Tunisia: implication for molecular diagnosis.
19434073 2009 Common variations in ERCC2 are associated with response to cisplatin chemotherapy and clinical outcome in osteosarcoma patients.
19350405 2009 Population study of genetic polymorphisms and superficial bladder cancer risk in Han-Chinese smokers in Shanghai.
19280628 2009 Genetic polymorphisms in DNA repair genes as modulators of Hodgkin disease risk.
19270000 2009 Genetic susceptibility to esophageal cancer: the role of the nucleotide excision repair pathway.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19177501 2009 Chromosomal aberrations in railroad transit workers: effect of genetic polymorphisms.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19124519 2009 DNA repair gene variants associated with benign breast disease in high cancer risk women.
19116388 2009 A field synopsis on low-penetrance variants in DNA repair genes and cancer susceptibility.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19027756 2009 Micronuclei and chromosomal aberrations, important markers of ageing: possible association with XPC and XPD polymorphisms.
18955168 2009 XPC initiation codon mutation in xeroderma pigmentosum patients with and without neurological symptoms.
18854777 2008 Germline genetic variations in drug action pathways predict clinical outcomes in advanced lung cancer treated with platinum-based chemotherapy.
18838045 2009 Inter-individual variation in nucleotide excision repair in young adults: effects of age, adiposity, micronutrient supplementation and genotype.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18809580 2008 Dissection of the molecular defects caused by pathogenic mutations in the DNA repair factor XPC.
18785488 2008 [Correlation of polymorphisms in xeroderma pigmentosum group C to the risk of ovarian carcinoma].
18774935 2008 Interaction of nucleotide excision repair factors XPC-HR23B, XPA, and RPA with damaged DNA.
18771913 2008 Associations between XPC polymorphisms and risk of cancers: A meta-analysis.
18709642 2008 Nucleotide excision repair genes and risk of lung cancer among San Francisco Bay Area Latinos and African Americans.
18701435 2008 Polygenic model of DNA repair genetic polymorphisms in human breast cancer risk.
18685619 2009 Identification of XP complementation groups by recombinant adenovirus carrying DNA repair genes.
18682493 2008 Versatile DNA damage detection by the global genome nucleotide excision repair protein XPC.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18645534 2008 Polymorphisms of the DNA repair gene XPA and XPC and its correlation with gastric cardiac adenocarcinoma in a high incidence population in North China.
18630471 DNA repair gene ERCC2, XPC, XRCC1, XRCC3 polymorphisms and associations with bladder cancer risk in a French cohort.
18574675 2008 Fluorescence correlation spectroscopy of the binding of nucleotide excision repair protein XPC-hHr23B with DNA substrates.
18559563 2008 Detecting pathway-based gene-gene and gene-environment interactions in pancreatic cancer.
18544627 2008 Polymorphisms in DNA repair genes, smoking, and pancreatic adenocarcinoma risk.
18478970 2007 Single nucleotide polymorphism analysis of the nucleotide excision repair genes XPC, XPA, and XPG in the Indian population.
18320070 2008 DNA repair gene polymorphisms may be associated with prognosis of upper urinary tract transitional cell carcinoma.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18285822 2008 XPC polymorphisms play a role in tissue-specific carcinogenesis: a meta-analysis.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18196582 2008 Polymorphisms in XPC and ERCC2 genes, smoking and breast cancer risk.
18177054 2008 The carboxy-terminal domain of xeroderma pigmentosum complementation group C protein, involved in TFIIH and centrin binding, is highly disordered.
18097734 2008 A meta-analysis of DNA repair gene XPC polymorphisms and cancer risk.
18089819 2007 Differential sensitivity of malignant glioma cells to methylating and chloroethylating anticancer drugs: p53 determines the switch by regulating xpc, ddb2, and DNA double-strand breaks.
18067564 2009 XPC gene polymorphisms and risk of idiopathic azoospermia or oligozoospermia in a Chinese population.
18053706 2008 Xeroderma pigmentosum complementation group C genotypes/diplotypes play no independent or interaction role with polycyclic aromatic hydrocarbons-DNA adducts for breast cancer risk.
18035379 2008 Influence of GSTM1 null and low repair XPC PAT+ on anti-B[a]PDE-DNA adduct in mononuclear white blood cells of subjects low exposed to PAHs through smoking and diet.
18024891 2007 Xeroderma pigmentosum C is involved in Epstein Barr virus DNA replication.
17932354 2007 Mutagen sensitivity and genetic variants in nucleotide excision repair pathway: genotype-phenotype correlation.
17923445 2008 Modulation of DNA damage/DNA repair capacity by XPC polymorphisms.
17913280 2008 Polymorphisms in nucleotide excision repair genes, smoking and intake of fruit and vegetables in relation to lung cancer.
17897675 2007 Structural, thermodynamic, and cellular characterization of human centrin 2 interaction with xeroderma pigmentosum group C protein.
17882560 2008 The xeroderma pigmentosum group C gene polymorphisms and genetic susceptibility of nasopharyngeal carcinoma.
17825393 2007 Moving toward individualized therapy based on NER polymorphisms that predict platinum sensitivity in ovarian cancer patients.
17712032 2007 The association of DNA repair gene polymorphisms with the development and progression of renal cell carcinoma.
17705814 2007 Polymorphisms in XPC, XPD, XRCC1, and XRCC3 DNA repair genes and lung cancer risk in a population of northern Spain.
17685459 2007 Polymorphism in nucleotide excision repair gene XPC correlates with bleomycin-induced chromosomal aberrations.
17684138 2007 Potentially functional single nucleotide polymorphisms in the core nucleotide excision repair genes and risk of squamous cell carcinoma of the head and neck.
17682058 2007 In vivo destabilization and functional defects of the xeroderma pigmentosum C protein caused by a pathogenic missense mutation.
17657713 2007 In vitro radiation-induced expression of XPC mRNA as a possible biomarker for developing adverse reactions during radiotherapy.
17653764 2008 Polymorphisms of the DNA repair gene xeroderma pigmentosum groups A and C and risk of esophageal squamous cell carcinoma in a population of high incidence region of North China.
17575242 2007 Nucleotide excision repair pathway genes and oral premalignant lesions.
17531525 2007 Polymorphisms in base-excision repair and nucleotide-excision repair genes in relation to lung cancer risk.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17508409 2007 Reduced XPC messenger RNA level may predict a poor outcome of patients with nonsmall cell lung cancer.
17498315 2007 Sequence variations in DNA repair gene XPC is associated with lung cancer risk in a Chinese population: a case-control study.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17438703 2007 Polymorphisms in XPD, XPC and the risk of death in patients with urinary bladder neoplasms.
17374967 2006 Association between DNA repair gene polymorphisms and p53 alterations in Japanese patients with muscle-invasive bladder cancer.
17363013 2007 XPA A23G, XPC Lys939Gln, XPD Lys751Gln and XPD Asp312Asn polymorphisms, interactions with smoking, alcohol and dietary factors, and risk of colorectal cancer.
17355181 2007 An aromatic sensor with aversion to damaged strands confers versatility to DNA repair.
17325666 2007 Xeroderma pigmentosum group C gene expression is predominantly regulated by promoter hypermethylation and contributes to p53 mutation in lung cancers.
17196815 2007 Polymorphisms of DNA repair genes are risk factors for prostate cancer.
17164382 2006 Comprehensive analysis of 22 XPC polymorphisms and bladder cancer risk.
17164380 2006 Polymorphisms in the DNA repair genes XPC, XPD, and XPG and risk of cutaneous melanoma: a case-control analysis.
17119055 2006 Genetic variation in the nucleotide excision repair pathway and colorectal cancer risk.
17088560 2006 DNA nucleotide excision repair-dependent signaling to checkpoint activation.
17086695 2006 [Polymorphisms of the DNA repair genes XRCC1 and XPC: relationship to pancreatic cancer risk].
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17078101 2006 Influence of polymorphisms in xenobiotic-metabolizing genes and DNA-repair genes on diepoxybutane-induced SCE frequency.
17052994 2007 Genotypes, haplotypes and diplotypes of XPC and risk of bladder cancer.
16985021 2006 Polymorphisms in nucleotide excision repair genes and DNA repair capacity phenotype in sisters discordant for breast cancer.
16965652 2006 [Correlation of XPC Ala499Val and Lys939Gln polymorphisms to risks of esophageal squamous cell carcinoma and gastric cardiac adenocarcinoma].
16957781 2006 New functions of XPC in the protection of human skin cells from oxidative damage.
16858626 2006 UV-induced ubiquitylation of XPC complex, the UV-DDB-ubiquitin ligase complex, and DNA repair.
16823510 2007 Breast cancer risk is not associated with polymorphic forms of xeroderma pigmentosum genes in a cohort of women from Washington County, Maryland.
16820684 2006 Crystallization and preliminary X-ray diffraction data of the complex between human centrin 2 and a peptide from the protein XPC.
16794584 2006 A novel complex insertion/deletion mutation in the XPC DNA repair gene leads to skin cancer in an Iraqi family.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16627479 2006 The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.
16571649 2006 The XPD 751Gln allele is associated with an increased risk for esophageal adenocarcinoma: a population-based case-control study in Sweden.
16537713 2006 Genetic variation in the nucleotide excision repair pathway and bladder cancer risk.
16533048 2006 Flexibility and plasticity of human centrin 2 binding to the xeroderma pigmentosum group C protein (XPC) from nuclear excision repair.
16527807 2006 Cullin 4A-mediated proteolysis of DDB2 protein at DNA damage sites regulates in vivo lesion recognition by XPC.
16510122 2006 Polymorphisms of DNA repair genes are associated with renal cell carcinoma.
16492920 2006 Nucleotide excision repair gene polymorphisms and risk of advanced colorectal adenoma: XPC polymorphisms modify smoking-related risk.
16399771 2006 Polymorphisms in nucleotide excision repair genes, smoking and breast cancer in African Americans and whites: a population-based case-control study.
16393248 2006 Gene-environment interaction involved in oral carcinogenesis: molecular epidemiological study for metabolic and DNA repair gene polymorphisms.
16373199 2006 Polymorphism in DNA repair genes and oral squamous cell carcinoma in Thailand.
16351803 2005 [Correlation of genetic polymorphisms in nucleotide excision repair system to sensitivity of advanced non-small cell lung cancer patients to platinum-based chemotherapy].
16284373 2005 Interindividual variation in nucleotide excision repair genes and risk of endometrial cancer.
16258177 2006 Polymorphisms in nucleotide excision repair genes and risk of multiple primary melanoma: the Genes Environment and Melanoma Study.
16105547 2005 HHR23A, a human homolog of Saccharomyces cerevisiae Rad23, regulates xeroderma pigmentosum C protein and is required for nucleotide excision repair.
16086280 2005 [Association of two exonic genetic polymorphisms in the DNA repair gene XPC with risk of lung cancer in Chinese population].
16081512 2006 Reduced XPC DNA repair gene mRNA levels in clinically normal parents of xeroderma pigmentosum patients.
16061005 2005 [Polymorphisms in nucleotide excision repair genes XPC and XPD and clinical responses to platinum-based chemotherapy in advanced non-small cell lung cancer].
16043197 2006 Genetic polymorphisms and possible gene-gene interactions in metabolic and DNA repair genes: effects on DNA damage.
16002061 2005 Single nucleotide polymorphisms for DNA repair genes in breast cancer patients.
15992842 2005 DNA repair and cyclin D1 polymorphisms and styrene-induced genotoxicity and immunotoxicity.
15964821 2005 Centrin 2 stimulates nucleotide excision repair by interacting with xeroderma pigmentosum group C protein.
15922480 2005 Overexpression of the two nucleotide excision repair genes ERCC1 and XPC in human hepatocellular carcinoma.
15914210 2005 Basal cell carcinoma and variants in genes coding for immune response, DNA repair, folate and iron metabolism.
15886698 2005 The polyAT, intronic IVS11-6 and Lys939Gln XPC polymorphisms are not associated with transitional cell carcinoma of the bladder.
15882621 2005 UV-induced ubiquitylation of XPC protein mediated by UV-DDB-ubiquitin ligase complex.
15878910 2005 Polymorphisms in DNA repair genes in the molecular pathogenesis of esophageal (Barrett) adenocarcinoma.
15863269 2005 The XPC poly-AT polymorphism in non-melanoma skin cancer.
15849729 2005 Polymorphisms in the DNA nucleotide excision repair genes and lung cancer risk in Xuan Wei, China.
15837542 2005 Combinations of polymorphisms in XPD, XPC and XPA in relation to risk of lung cancer.
15746160 2005 Constitutional short telomeres are strong genetic susceptibility markers for bladder cancer.
15731165 2005 Assessment of 3 xeroderma pigmentosum group C gene polymorphisms and risk of cutaneous melanoma: a case-control study.
15729698 2005 XPC polymorphisms and lung cancer risk.
15700316 2005 DNA repair gene XPC genotypes/haplotypes and risk of lung cancer in a Chinese population.
15661662 2005 Nucleosomal structure of undamaged DNA regions suppresses the non-specific DNA binding of the XPC complex.
15657918 2005 Associations between XPC expression, genotype, and the risk of head and neck cancer.
15623356 Molecular responses to stress induced in normal human caucasian melanocytes in culture by exposure to simulated solar UV.
15533908 2004 Poly (AT) polymorphism in intron 11 of the XPC DNA repair gene enhances the risk of lung cancer.
15494739 2005 No association between three xeroderma pigmentosum group C and one group G gene polymorphisms and risk of cutaneous melanoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471894 2005 Reduced nucleotide excision repair and GSTM1-null genotypes influence anti-B[a]PDE-DNA adduct levels in mononuclear white blood cells of highly PAH-exposed coke oven workers.
15353127 2004 The involvement of XPC protein in the cisplatin DNA damaging treatment-mediated cellular response.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15231747 2004 A protein interaction framework for human mRNA degradation.
15107491 2004 The initiative role of XPC protein in cisplatin DNA damaging treatment-mediated cell cycle regulation.
15010895 2004 Single nucleotide polymorphisms in breast cancer.
14729591 2004 Genetic polymorphisms in DNA repair genes and possible links with DNA repair rates, chromosomal aberrations and single-strand breaks in DNA.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14690560 2003 [Poly(AT) polymorphism in DNA repair gene XPC and lung cancer risk].
14688016 2004 Polymorphisms in DNA repair and metabolic genes in bladder cancer.
12944386 2003 In vivo recruitment of XPC to UV-induced cyclobutane pyrimidine dimers by the DDB2 gene product.
12890685 2003 Xeroderma pigmentosum group C protein possesses a high affinity binding site to human centrin 2 and calmodulin.
12815074 2003 A novel regulation mechanism of DNA repair by damage-induced and RAD23-dependent stabilization of xeroderma pigmentosum group C protein.
12713809 2003 Tumor suppressor p53 dependent recruitment of nucleotide excision repair factors XPC and TFIIH to DNA damage.
12547395 2003 DNA bending by the human damage recognition complex XPC-HR23B.
12509299 2002 A molecular mechanism for DNA damage recognition by the xeroderma pigmentosum group C protein complex.
12509233 2002 The carboxy-terminal domain of the XPC protein plays a crucial role in nucleotide excision repair through interactions with transcription factor IIH.
12505994 2003 Xeroderma pigmentosum group C protein interacts physically and functionally with thymine DNA glycosylase.
12496474 Transactivation of repair genes by BRCA1.
12486030 2003 Biochemical analysis of the damage recognition process in nucleotide excision repair.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12242345 2002 p53 and DNA damage-inducible expression of the xeroderma pigmentosum group C gene.
12177305 2002 The human XPC DNA repair gene: arrangement, splice site information content and influence of a single nucleotide polymorphism in a splice acceptor site on alternative splicing and function.
11872635 2002 Modulation of repair of ultraviolet damage in the host-cell reactivation assay by polymorphic XPC and XPD/ERCC2 genotypes.
11279143 2001 Centrosome protein centrin 2/caltractin 1 is part of the xeroderma pigmentosum group C complex that initiates global genome nucleotide excision repair.
11259578 2001 Strong functional interactions of TFIIH with XPC and XPG in human DNA nucleotide excision repair, without a preassembled repairosome.
10873465 2000 Stable binding of human XPC complex to irradiated DNA confers strong discrimination for damaged sites.
10766188 2000 Mutations in the XPC gene in families with xeroderma pigmentosum and consequences at the cell, protein, and transcript levels.
10734143 2000 The xeroderma pigmentosum group C protein complex XPC-HR23B plays an important role in the recruitment of transcription factor IIH to damaged DNA.
10583946 1999 Quality control by DNA repair.
10488153 1999 Interaction of hHR23 with S5a. The ubiquitin-like domain of hHR23 mediates interaction with S5a subunit of 26 S proteasome.
10447254 1999 A summary of mutations in the UV-sensitive disorders: xeroderma pigmentosum, Cockayne syndrome, and trichothiodystrophy.
10214908 DNA damage recognition during nucleotide excision repair in mammalian cells.
9804340 1998 Xeroderma pigmentosum group C splice mutation associated with autism and hypoglycinemia.
9734359 1998 Xeroderma pigmentosum group C protein complex is the initiator of global genome nucleotide excision repair.
9415314 1997 Retrovirus-mediated gene transfer corrects DNA repair defect of xeroderma pigmentosum cells of complementation groups A, B and C.
9372924 1997 Two human homologs of Rad23 are functionally interchangeable in complex formation and stimulation of XPC repair activity.
9164480 1997 XPC interacts with both HHR23B and HHR23A in vivo.
8692695 1996 XPC and human homologs of RAD23: intracellular localization and relationship to other nucleotide excision repair complexes.
8604333 1996 Sequence of the mouse XPC cDNA and genomic structure of the human XPC gene.
8298653 1993 Characterization of molecular defects in xeroderma pigmentosum group C.
8168482 1994 Purification and cloning of a nucleotide excision repair complex involving the xeroderma pigmentosum group C protein and a human homologue of yeast RAD23.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8088800 1994 Assignment of xeroderma pigmentosum group C (XPC) gene to chromosome 3p25.
8077226 1994 DNA repair defect in xeroderma pigmentosum group C and complementing factor from HeLa cells.
1522891 1992 Expression cloning of a human DNA repair gene involved in xeroderma pigmentosum group C.
1461286 1992 Expression cloning of a human DNA repair gene involved in xeroderma pigmentosum group C.