Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.66
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung adenocarcinoma 2716 4.6e-08
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Heart disease 306 0.0 0.7
Osteoporosis 363 0.0 2.4

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma 1.100 4.6e-08

Synonym

Accession Q5GH70 B2RNS9 B9EH74
Symbols XRG9

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MKYTKQNFMMSVLGIIIYVTDLIVDIWVSVRFFHEGQYVFSALALSFMLFGTLVAQCFSYSWFKADLKKA      1 - 70
GQESQHCFLLLHCLQGGVFTRYWFALKRGYHAAFKYDSNTSNFVEEQIDLHKEVIDRVTDLSMLRLFETY     71 - 140
LEGCPQLILQLYILLEHGQANFSQYAAIMVSCCAISWSTVDYQVALRKSLPDKKLLNGLCPKITYLFYKL    141 - 210
FTLLSWMLSVVLLLFLNVKIALFLLLFLWLLGIIWAFKNNTQFCTCISMEFLYRIVVGFILIFTFFNIKG    211 - 280
QNTKCPMSCYYIVRVLGTLGILTVFWVCPLTIFNPDYFIPISITIVLTLLLGILFLIVYYGSFHPNRSAE    281 - 350
TKCDEIDGKPVLRECRMRYFLME                                                   351 - 373
//

Text Mined References (4)

PMID Year Title