Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.92
PubTator Score 2.17

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H6D3 hXkr8
Symbols XRG8
hXkr8

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
26936867 facilitates transbilayer migration of lipids [review]
23845944 findings show the Xk-family protein Xkr8 mediates phosphatidylserine exposure in response to apoptotic stimuli; Xk-family proteins have evolutionarily conserved roles in promoting phagocytosis of dying cells by altering the phospholipid distribution in the plasma membrane

AA Sequence

MPWSSRGALLRDLVLGVLGTAAFLLDLGTDLWAAVQYALGGRYLWAALVLALLGLASVALQLFSWLWLRA      1 - 70
DPAGLHGSQPPRRCLALLHLLQLGYLYRCVQELRQGLLVWQQEEPSEFDLAYADFLALDISMLRLFETFL     71 - 140
ETAPQLTLVLAIMLQSGRAEYYQWVGICTSFLGISWALLDYHRALRTCLPSKPLLGLGSSVIYFLWNLLL    141 - 210
LWPRVLAVALFSALFPSYVALHFLGLWLVLLLWVWLQGTDFMPDPSSEWLYRVTVATILYFSWFNVAEGR    211 - 280
TRGRAIIHFAFLLSDSILLVATWVTHSSWLPSGIPLQLWLPVGCGCFFLGLALRLVYYHWLHPSCCWKPD    281 - 350
PDQVDGARSLLSPEGYQLPQNRRMTHLAQKFFPKAKDEAASPVKG                             351 - 395
//

Text Mined References (7)

PMID Year Title
26936867 2016 Getting to the Outer Leaflet: Physiology of Phosphatidylserine Exposure at the Plasma Membrane.
23845944 2013 Xk-related protein 8 and CED-8 promote phosphatidylserine exposure in apoptotic cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.