Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.56
PubTator Score 2.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer -1.100 1.1e-03
ependymoma -1.200 1.1e-08
intraductal papillary-mucinous adenoma (... 1.100 7.4e-04
medulloblastoma, large-cell 1.100 8.5e-05
osteosarcoma 1.044 8.7e-06
pituitary cancer -1.200 7.0e-04
subependymal giant cell astrocytoma -2.319 1.7e-02

Gene RIF (3)

AA Sequence

MAAKSDGGGVGVGFAQLHNLDEAVGSGGEEDGEPGGGGCGGGGDGSEPGESSSMHICHCCNTSSCYWGCR      1 - 70
SACLRSLLGRKPRRSAAADGGDQPLQPPAAPGAGRQPPTPSAARPEPPPPQVERPWLDCLWIVLALLVFF     71 - 140
GDVGTDLWLALDYYRKGDYVYFGLTLFFVLVPSLLVQSLSFRWFVQDYTGGGLGAVEGLTSRGPPMMGAG    141 - 210
YVHGAARGGPGVRVSPTPGAQRLCRLSVWIWQSVIHLLQMGQVWRYIRTMYLGIQSQRRKEHQRRFYWAM    211 - 280
MYEYADVNMLRLLETFLESAPQLVLQLYIMLQKNSAETLPCVSSVTSLMSLAWVLASYHKLLRDSRDDKK    281 - 350
SMSYRGAIIQVFWRLFTISSRVISFALFASIFQLYFGIFVVVHWCAMAFWIIHGGTDFCMSKWEEILFNM    351 - 420
VVGIVYIFCWFNVKEGRTRYRMFAYYTIVLTENAALTFLWYFYRDPETTDSYAVPALCCVFISFVAGIAM    421 - 490
MLLYYGVLHPTGPRAKILASSCCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVTEQQEDLTADTCL    491 - 560
PVFQVRPMGPPTPLGRPYLPEGPLIKIDMPRKRYPAWDAHFVDRRLRRTINILQYVTPTAVGIRYRDGPL    561 - 630
LYELLQYESSL                                                               631 - 641
//

Text Mined References (13)

PMID Year Title