Property Summary

NCBI Gene PubMed Count 31
PubMed Score 21.09
PubTator Score 364.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count
McLeod neuroacanthocytosis syndrome 1

Expression

  Differential Expression (30)

Disease log2 FC p
adult high grade glioma -2.600 7.4e-05
astrocytic glioma -3.600 1.7e-03
Astrocytoma, Pilocytic -2.600 3.5e-07
atypical teratoid / rhabdoid tumor -3.200 7.6e-07
Endometriosis -1.104 4.5e-02
ependymoma -3.000 1.4e-02
gastric cancer 2.100 3.9e-04
glioblastoma -2.300 1.7e-05
group 3 medulloblastoma -1.800 3.3e-03
hepatocellular carcinoma 1.800 6.5e-04
interstitial cystitis -1.500 7.6e-03
intraductal papillary-mucinous adenoma (... 1.800 2.2e-02
intraductal papillary-mucinous carcinoma... 2.100 1.3e-03
intraductal papillary-mucinous neoplasm ... 2.200 1.2e-03
lung cancer -3.400 7.4e-05
lung carcinoma 1.600 1.5e-28
medulloblastoma, large-cell -2.400 1.8e-04
oligodendroglioma -3.200 9.7e-03
osteosarcoma -6.425 3.4e-06
ovarian cancer 1.400 3.9e-03
pancreatic cancer 2.800 1.0e-04
pancreatic carcinoma 2.800 1.0e-04
Pick disease -1.200 4.1e-02
primitive neuroectodermal tumor -3.100 5.0e-05
psoriasis -1.200 2.0e-03
spina bifida -2.489 1.7e-02
subependymal giant cell astrocytoma -2.547 1.1e-03
tuberculosis 1.700 3.6e-03
ulcerative colitis -1.300 6.2e-04
urothelial carcinoma -2.100 3.8e-02

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MKFPASVLASVFLFVAETTAALSLSSTYRSGGDRMWQALTLLFSLLPCALVQLTLLFVHRDLSRDRPLVL      1 - 70
LLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSRAS     71 - 140
VIQAFLGSAPQLTLQLYISVMQQDVTVGRSLLMTISLLSIVYGALRCNILAIKIKYDEYEVKVKPLAYVC    141 - 210
IFLWRSFEIATRVVVLVLFTSVLKTWVVVIILINFFSFFLYPWILFWCSGSPFPENIEKALSRVGTTIVL    211 - 280
CFLTLLYTGINMFCWSAVQLKIDSPDLISKSHNWYQLLVYYMIRFIENAILLLLWYLFKTDIYMYVCAPL    281 - 350
LVLQLLIGYCTAILFMLVFYQFFHPCKKLFSSSVSEGFQRWLRCFCWACRQQKPCEPIGKEDLQSSRDRD    351 - 420
ETPSSSKTSPEPGQFLNAEDLCSA                                                  421 - 444
//

Text Mined References (29)

PMID Year Title