Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.97
PubTator Score 7.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.2e-11

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 3.2e-11

Gene RIF (6)

AA Sequence

MRLLILALLGICSLTAYIVEGVGSEVSHRRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCA      1 - 70
DPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG                               71 - 114
//

Text Mined References (16)

PMID Year Title