Property Summary

NCBI Gene PubMed Count 48
PubMed Score 293.94
PubTator Score 107.56

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession P47992 Q52MA8
Symbols LTN
ATAC
LPTN
SCM1
SCM-1
SCM1A
SCYC1
SCM-1a

Gene

PDB

1J8I   1J9O   2HDM   2JP1   2N54   2NYZ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (33)

PMID Text
26836755 This study defines a Glycosaminoglycan binding surface on XCL1 dimer that includes residues that are important for HIV-1 inhibition.
26134347 Electrostatics and Hydrophobic Effects in the Metamorphic Protein Human Lymphotactin
26085164 XCL1 acts via direct interaction with the external viral envelope glycoprotein, gp120, to block HIV-1 infection
26085164 HIV-1 gp120 interacts with XCL1 electrostatically; the K42R mutation in XCL1 maintained anti-HIV (IIIB and BAL) capacity whilst K42A mutation completely abrogates XCL1 anti-HIV-1 activity
25497737 analysis of XCL1 and XCL2, members of the C-chemokine subfamily, in the immune system
25449536 identified 13 ADCC-activated genes. Six gene expression assays including 8 of the 13 genes (CCL3, CCL4/CCL4L1/CCL4L2, CD160, IFNG, NR4A3 and XCL1/XCL2) were analyzed in 127 kidney biopsies
24899193 HIV-1 gp120 interacts with XCL1 electrostatically; the K42R mutation in XCL1 maintained anti-HIV (IIIB and BAL) capacity whilst K42A mutation completely abrogates XCL1 anti-HIV-1 activity
24385911 XCL1-mediated inhibition is associated with direct interaction of the chemokine with the HIV-1 envelope.
24385911 HIV-1 gp120 interacts with XCL1 electrostatically; the K42R mutation in XCL1 maintained anti-HIV (IIIB and BAL) capacity whilst K42A mutation completely abrogates XCL1 anti-HIV-1 activity
21270681 In native annulus fibrosus tissue homeostasis and repair, CXCR3 is evident, whereas XCL1 could not be detected.
20541533 The expression patterns of XCR1 and XCL1 were conserved in human and mice blood cells, including certain dendritic cell subsets.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19797511 Data indicated increased expression of XCL1 in CD4+ and CD8+ T cells in Wegener's granulomatosis (WG), and suggest that XCL1 might be a key modulator of T cell recruitment in WG.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
18838386 ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein
18832695 XCL1 enhances regulatory activities of CD4+ CD25(high) CD127(low/-) T cells in human allergic asthma
18364395 functional repertoire and regulation of a single naturally occurring amino acid sequence can be expanded by access to a set of highly dissimilar native-state structures
18322986 Elevated serum lymphotactin levels correlate with relatively milder manifestations in diffuse cutaneous systemic sclerosis (dSSc), especially lower severity of lung involvement, suggesting that lymphotactin may play a role in the development of dSSc.
17077010 The monocyte-derived dendritic cells can express Lptn mRNA in a maturation-dependent manner.
16923584 description of a lymphotactin-producing monoclonal T-cell lymphoproliferative disorder with extreme lymphocytopenia and progressive leukoencephalopathy [case report]
15857508 HIV-1 gp120 interacts with XCL1 electrostatically; the K42R mutation in XCL1 maintained anti-HIV (IIIB and BAL) capacity whilst K42A mutation completely abrogates XCL1 anti-HIV-1 activity
14734774 XCL1 activation is positively correlated with HIV-1 Tat expression in human U87.MG astrocytes in vitro.
14734774 HIV-1 gp120 interacts with XCL1 electrostatically; the K42R mutation in XCL1 maintained anti-HIV (IIIB and BAL) capacity whilst K42A mutation completely abrogates XCL1 anti-HIV-1 activity
14707146 lymphotactin utilizes highly specific glycosaminoglycan-binding sites
14568926 In humans XCL1 expression is mainly a property of CD8+ T cells; the contribution to its synthesis by different T cell receptor alpha beta-expressing T cell subsets, namely CD4+ lymphocytes, is negligible.
12949249 XCL1 displays antimicrobial activity against E. coli and S. aureus.
12847680 Lptn might be a key modulator for T cell trafficking in the pathogenesis of rheumatoid arthritis
12393716 Lymphotactin, (MIP)-1alpha, and MIP-1beta chemokines were all rapidly induced by engagement of CD28 and were calcineurin sensitive.
12053063 lymphotactin, as well as MCP-1, may contribute to leukocyte infiltration and disease progression in IgA nephropathy.
11889129 NMR spectra of human lymphotactin (hLtn), obtained under various solution conditions, have revealed that the protein undergoes a major conformational rearrangement dependent on temperature and salt concentration.
11878903 HIV-1 gp120 interacts with XCL1 electrostatically; the K42R mutation in XCL1 maintained anti-HIV (IIIB and BAL) capacity whilst K42A mutation completely abrogates XCL1 anti-HIV-1 activity

AA Sequence

MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCA      1 - 70
DPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG                               71 - 114
//

Text Mined References (48)

PMID Year Title
26836755 2016 Examination of Glycosaminoglycan Binding Sites on the XCL1 Dimer.
26134347 2015 Interplay of Electrostatics and Hydrophobic Effects in the Metamorphic Protein Human Lymphotactin.
26085164 2015 Structural Determinants for the Selective Anti-HIV-1 Activity of the All-? Alternative Conformer of XCL1.
25497737 2015 Structural and agonist properties of XCL2, the other member of the C-chemokine subfamily.
25449536 2015 Genes associated with antibody-dependent cell activation are overexpressed in renal biopsies from patients with antibody-mediated rejection.
24385911 2013 The CD8-derived chemokine XCL1/lymphotactin is a conformation-dependent, broad-spectrum inhibitor of HIV-1.
21270681 2012 The chemokines CXCL10 and XCL1 recruit human annulus fibrosus cells.
20541533 2010 Conservation of a chemokine system, XCR1 and its ligand, XCL1, between human and mice.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19797511 2009 Expression and function of the C-class chemokine lymphotactin (XCL1) in Wegener's granulomatosis.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
18838386 2008 Human ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein.
18832695 2008 XCL1 enhances regulatory activities of CD4+ CD25(high) CD127(low/-) T cells in human allergic asthma.
18364395 2008 Interconversion between two unrelated protein folds in the lymphotactin native state.
18322986 2008 Elevation of serum lymphotactin levels in patients with systemic sclerosis.
17903295 2007 Genetic correlates of longevity and selected age-related phenotypes: a genome-wide association study in the Framingham Study.
17077010 2006 [Preliminary study on lymphotactin expression of monocyte-derived dendritic cells].
16923584 2006 A lymphotactin-producing monoclonal T-cell lymphoproliferative disorder with extreme lymphocytopenia and progressive leukoencephalopathy.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14734774 2004 Induction of C chemokine XCL1 (lymphotactin/single C motif-1 alpha/activation-induced, T cell-derived and chemokine-related cytokine) expression by HIV-1 Tat protein.
14707146 2004 Identification and characterization of a glycosaminoglycan recognition element of the C chemokine lymphotactin.
14568926 2003 CD8+ alpha beta+ T cells that lack surface CD5 antigen expression are a major lymphotactin (XCL1) source in peripheral blood lymphocytes.
12949249 2003 Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.
12847680 2003 Expression of activation-induced, T cell-derived, and chemokine-related cytokine/lymphotactin and its functional role in rheumatoid arthritis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393716 2003 Differential chemokine expression profiles in human peripheral blood T lymphocytes: dependence on T-cell coreceptor and calcineurin signaling.
12053063 2002 Enhanced expression of C chemokine lymphotactin in IgA nephropathy.
11683588 2001 Staphylococcal superantigens induce lymphotactin production by human CD4+ and CD8+ T cells.
11601972 2001 Monomeric solution structure of the prototypical 'C' chemokine lymphotactin.
11446740 2001 Role of C chemokine lymphotactin in mediating recruitment of antigen-specific CD62L(lo) cells in vitro and in vivo.
11303872 2001 Chemical synthesis of lymphotactin: a glycosylated chemokine with a C-terminal mucin-like domain.
11154210 2001 Expression and regulation of chemokine receptors in human natural killer cells.
11083865 2001 Versican interacts with chemokines and modulates cellular responses.
10887101 2000 The C-class chemokine, lymphotactin, impairs the induction of Th1-type lymphokines in human CD4(+) T cells.
10433555 1999 Expression of SCM-1alpha/lymphotactin and SCM-1beta in natural killer cells is upregulated by IL-2 and IL-12.
9632725 1998 Identification of single C motif-1/lymphotactin receptor XCR1.
9199871 1997 Murine lymphotactin: gene structure, post-translational modification and inhibition of expression by CD28 costimulation.
9079718 1997 Purification, structural analysis, and function of natural ATAC, a cytokine secreted by CD8(+) T cells.
9029087 1997 Lymphotactin is produced by NK cells and attracts both NK cells and T cells in vivo.
8977329 1996 Migratory response of human natural killer cells to lymphotactin.
8849694 1996 Structure and expression of two highly related genes encoding SCM-1/human lymphotactin.
7973732 1994 Lymphotactin: a cytokine that represents a new class of chemokine.
7875320 1995 Molecular cloning of a novel C or gamma type chemokine, SCM-1.
7615002 1995 Cloning of ATAC, an activation-induced, chemokine-related molecule exclusively expressed in CD8+ T lymphocytes.
7602097 1995 Molecular cloning and functional characterization of human lymphotactin.