Property Summary

NCBI Gene PubMed Count 50
PubMed Score 310.54
PubTator Score 107.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (34)

AA Sequence

MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCA      1 - 70
DPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG                               71 - 114
//

Text Mined References (50)

PMID Year Title