Property Summary

NCBI Gene PubMed Count 192
PubMed Score 715.47
PubTator Score 457.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.400 4.6e-03
fibroadenoma 2.300 8.4e-04
Breast cancer -1.700 4.3e-06

Gene RIF (175)

PMID Text
26742428 Our results reveal that IRE1alpha-XBP1 pathway plays an important role in tumor progression and epithelial-to-mesenchymal transition (EMT), and IRE1alpha could be employed as a novel prognostic marker and a promising therapeutic target for CRC.
26680227 High XBP1 expression is associated with glioma.
26633383 Overexpression of X-Box Binding Protein 1 (XBP1) Correlates to Poor Prognosis and Up-Regulation of PI3K/mTOR in Human Osteosarcoma
26517687 Overexpression of XBP1 is associated with breast cancer.
26491160 These results provide evidence that XBP-1s is a direct activator of Kaposi's sarcoma-associated herpesvirus vIL-6 and that this is an important step in the pathogenesis of KSHV-Castleman disease and primary effusion lymphoma.
26483401 An RNA-intrinsic conformational change causes the intron of XBP1 mRNA to be ejected and the exons to zipper up into an extended stem, juxtaposing the RNA ends for ligation; These conformational rearrangements are important for XBP1 mRNA splicing in vivo
26469762 Data (including data from studies in transgenic/knockout mice) suggest insulin secretion in beta-cells is up-regulated in hyperglycemia via IRE1a- (inositol requiring enzyme 1 alpha)-mediated changes in XBP1 (X-box binding protein 1) mRNA splicing.
26331676 XBP-1 is required for cytokine production by inflamed human airway epithelia. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201504-0657OC#.VwqgNdLrvyA
26299655 The study supports a role for -116C/G polymorphism of the XBP1 promoter in the pathogenesis of T2D in a Chinese Han population
26134873 the present study provides initial evidence that RITA upregulates the expression level of IRE1a by increasing the stability of IRE1alpha mRNA in irradiated mtp53-expressing cervical cancer cells
26112372 these findings suggest a possible mechanism underlying the RANKL expression induced by wear particles in fibroblasts, and downregulating ER stress and the XBP1s expression of fibroblasts
26073941 Study shows that constitutive activation of XBP1 in tumor-associated dendritic cells drives ovarian cancer progression by blunting anti-tumor immunity.
25993558 Ire1alpha's key substrate, XBP1u mRNA, is recruited to the Ire1alpha-Sec61 translocon complex through its nascent chain, which contains a pseudo-transmembrane domain to utilize the signal recognition particle-mediated pathway.
25986851 review of the IRE1alpha-XBP1 branch of the unfolded protein response in human diseases [review]
25901709 we found that RACK1 was overexpressed in three human HCC cell lines and in HCC samples. Activation of the IRE1/XBP1 signaling pathway plays a protective role when HCC cells encounter endoplasmic reticulum (ER) stress due to in vitro sorafenib treatment.
25870107 Degradation of BLOC1S1 mRNA is temporally separate from XBP1 splicing and dispensable for cell viability under acute endoplasmic reticulum stress.
25754093 Defective podocyte insulin signaling through p85-XBP1 promotes ATF6-dependent maladaptive ER-stress response in diabetic nephropathy.
25692573 High XBP1 expression is associated with colorectal cancer cell invasion.
25656649 these findings suggest that miR-214 is an important regulator of angiogenesis in heart in vitro and in vivo, likely via regulating the expression of XBP1
25633224 GPR43 expression is reduced in monocytes upon siRNA-knockdown of XBP1, while A549 cells overexpressing XBP1 displayed elevated GPR43 levels.
25633195 Silencing of IRE1 expression inhibited splicing of XBP1 resulting in an early onset of cell death. In the PERK-reporter cells, authors observed that a slow rate of ATF4-translation and late re-initiation of general translation
25450523 our data demonstrate that CiC expression is activated during ER stress through the binding of ATF6alpha and XBP1 to an UPRE element located in the proximal promoter of Cic gene.
25448679 ROS increase production of an alternately spliced form of X-box binding protein 1 (XBP1s) and XBP1s increases HEPN1 expression by binding to the HEPN1 promoter
25437541 IRE1 has two different modes of action: XBP1/HAC1 is cleaved by IRE1 subunits acting cooperatively within IRE1 oligomers, whereas a single subunit of IRE1 performs regulated IRE1-dependent decay without cooperativity.
25426559 our results represent the first work demonstrating that GCN5 and PCAF exhibit different functions and antagonistically regulate the XBP-1S-mediated transcription.
25378478 RTCB, the catalytic subunit of the tRNA ligase complex, and its co-factor archease mediate XBP1 mRNA splicing both in vitro and in vivo.
25280941 This finding demonstrates the upregulated expression of the key epithelial- to-mesenchymal transition (EMT) regulator Snail and that it mediated EMT activation and cell invasion by XBP1.
25239945 XBP1u inhibits the UPR transcription factor XBP1s by targeting it toward proteasomal degradation.
25231123 XBP1-116C/G polymorphism is associated with an increased risk of bipolar disorder in Asian population
25216212 XBP1 translocates into the nucleus to initiate transcriptional programs that regulate a subset of unfolded protein response (UPR)- and non-UPR-associated genes involved in the pathophysiological processes of various diseases. [Review]
25190803 XBP1u and HDAC3 exert a protective effect on disturbed flow-induced oxidative stress via up-regulation of mTORC2-dependent Akt1 phosphorylation and Nrf2-mediated HO-1 expression.
25170079 The IRE1alpha-XBP1 pathway of the unfolded protein response could directly activate the transcriptional expression of Fgf21.
24909686 We showed that the specific HDAC6 inhibitor Tubastatin A could up-regulate XBP1s transcriptional activity, thereby increasing anti-oxidative genes expression.
24821775 The unfolded protein response pathway and its downstream effector XBP1 are therapeutic targets to overcome drug resistance in pre-B acute lymphoblastic leukemia.
24762547 EBV replication is associated with plasma cell differentiation and XBP1 activation
24670641 findings reveal a key function for the XBP1 branch of the unfolded protein response in triple-negative breast cancer; targeting this pathway may offer alternative treatment strategies for this aggressive subtype of breast cancer
24497562 High XBP1 expression is a marker of better outcome in multiple myeloma patients treated with bortezomib.
24387801 TLR dependent XBP-1 activation induces an autocrine loop in rheumatoid arthritis synoviocytes.
24356728 The modest activation of the unfolded protein response pathway enables myeloma cells to further differentiate via the action of XBP-1.
24269637 XBP1S was a negative regulator of apoptosis in osteoarthritis by affecting caspase 3, caspase 9, caspase 12, p-JNK1, and CHOP.
24194940 XBP1 splicing, ER stress and the UPR in NEC are associated with increased IL6 and IL8 expression levels, altered T cell differentiation and severe epithelial injury.
24165480 Results demonstrate that XBP-1 is a driver of ADAM10 gene expression and that disturbance of this pathway might contribute to development or progression of AD.
24029229 Xbp1s-negative tumor B cells and pre-plasmablasts mediate therapeutic proteasome inhibitor resistance in multiple myeloma.
24027308 mRNA isoforms of XBP1 is associated with Epstein-Barr virus lytic trans-activator BZLF1.
23930139 Review that discusses the central role of XBP1 and the unfolded protein response in antiestrogen resistant breast cancers.
23737521 Data indicate taht endoplasmic reticulum stress element (ERSE)-26 is transactivated by X-box-binding protein 1 (XBP).
23560553 Mutation c.499C>A (Leu167Ile) in the splicing region of XBP1 mRNA prevents splicing due to the disruption of the stem loop structure and may confer resistance to bortezomib in multiple myeloma patients
23510626 This is the first study to evaluate the effect of XBP1 polymorphism on severe chemotherapy-related adverse outcomes in platinum-treated advanced NSCLC patients using both pharmacogenomics and functional molecular analyses.
23470653 Suppression of UBC9 expression by RNA interference reduced both the expression of pXBP1(S) and ER stress-induced transcription by pXBP1
23447676 a parkin-dependent ER-stress-associated modulation of DJ-1 and identifies p53 and XBP-1 as two major actors acting downstream of parkin in this signaling cascade in cells and in vivo.
23421912 A role for the -116C/G polymorphism of the XBP1 gene is supported in the pathogenesis of Alzheimer's disease.
23335490 Report on the establishment of an engineered CHOS cell line that has been engineered to express both XBP-1S) and ERO1-Lalpha and has been named CHOS-XE. CHOS-XE cells produced increased antibody (MAb) yields (5.3- 6.2 fold) in comparison to CHOS cells.
23277279 XBP-1u suppresses autophagy by promoting the degradation of FoxO1 in cancer cells.
23184933 results suggest that XBP1 mRNA splicing triggers an autophagic signal pathway through transcriptional regulation of BECLIN-1
22925926 XBP-1 deficiency demonstrates that the gene regulatory program controlling plasma cell differentiation can proceed relatively normally in the absence of high rates of immunoglobulin secretion.
22787145 IRE1/XBP1 controls the induction of autophagy/ERAD(II) during the unfolded protein response by activating the ER membrane transporter SLC33A1/AT-1
22679299 The authors propose a non-traditional XBP1 pathway with enhanced sXBP1 as a novel disease-contributing mechanism in TNF-alpha associated periodic syndrome.
22669460 a novel critical role of XBP1S in ERS-mediated apoptosis and the molecular mechanisms involved
22644804 High glucose increased spliced XBP-1 expression in renal proximal tubular cells in a time-dependent manner. The PI3K/Akt pathway is involved in spliced XBP-1 up-regulation, which mediates lipid accumulation.
22469468 the inhibition of XBP1s by viral infection may underlie viral entry.
22445760 a significant reduction in the accumulation of Htt588(Q95)-mRFP intracellular inclusion was observed when XBP1 was co-expressed in the striatum.
22427205 XBP1s is a pathogenic factor underlying bone marrow stem cell support of multiple myeloma cell growth and osteoclast formation.
22422988 Review that places the unfolded protein response and signaling, including that driven by XBP1, as central determinants of the balance between prosurvival autophagy and prodeath apoptosis in determining cell fate in breast cancer.
22370484 de-SUMOylation is essential for SENP1 modulating XBP1 transcriptional activity.
22002058 The unfolded protein response (UPR)-activated transcription factor X-box-binding protein 1 (XBP1) induces microRNA-346 expression that targets the human antigen peptide transporter 1 (TAP1) mRNA and governs immune regulatory genes.
21924241 These results suggest that RNA ligase Trl1 for tRNA splicing might therefore commonly function as an RNA ligase for XBP1 mRNA splicing.
21858728 Data from material procured by laser capture microdissection suggest that coordinated expression of XBP1 and ESR1 in breast carcinoma is due to their co-expression in carcinoma cells rather than in the surrounding stromal cells.
21677677 The authors identify XBP1 and the unfolded protein response as critical components in the first framework for mathematically modeling estrogen receptor signaling in breast cancer.
21660045 data demonstrate the distinct immunogenic characteristics of unique heteroclitic XBP1 peptides, which induce MM-specific CTLs and highlights their potential application for immunotherapy to treat the patients with MM or its pre-malignant condition
21423203 Ets-1 was transcriptionally upregulated by ER stress. This was mediated by the IRE1alpha/XBP-1 branch of the unfolded protein response
21385877 early DENV-2 infection triggers and then suppresses PERK-mediated eIF2alpha phosphorylation and that in mid and late DENV-2 infection, the IRE1-XBP1 and ATF6 pathways are activated, respectively
21233347 nascent peptide encoded by XBP1u mRNA drags the mRNA-ribosome-nascent chain complex (R-RNC)to the membrane for efficient cytoplasmic splicing; found that translation of the XBP1u mRNA was briefly paused to stabilize the R-RNC complex
21138840 a protective effect of ER stress preconditioning against retinal endothelial inflammation, which is likely through activation of XBP1-mediated unfolded protein response (UPR) and inhibition of NF-kappaB activation.
21138464 XBP1 confers an important role in protection against oxidative stress in gliomas
21129257 Up-regulation of unspliced XBP-1 expression plays an important role in the differentiation of myeloma cells.
21129256 xbp-1 gene silencing can significantly enhance the pro-apoptotic activity of bortezomib in multiple myeloma cells.
21085187 Comprehensive association analysis of candidate genes for generalized vitiligo supports XBP1, FOXP3, and TSLP.
21085187 Observational study of gene-disease association. (HuGE Navigator)
21061914 XBP1 represents the most conserved signaling component of unfolded protein response and is critical for cell fate determination in response to endoplasmic reticulum stress.
21050047 A set of XBP-1 monoclonal antibodies were raised and cloned.
20980528 This study concluded that XBP-1 specifically reactivates the Kaposi sarcoma herpes virus lytic cycle in dually infected primary effusion lymphoma cells.
20955178 p300 increases the acetylation and protein stability of XBP1s, and enhances its transcriptional activity, whereas SIRT1 deacetylates XBP1s and inhibits its transcriptional activity
20688044 these studies identified the downregulation of spliced XBP-1 transcripts, a key player in the endoplasmic reticulum stress response, as a biochemical marker of HPV-16 E5 expression.
20421453 This study highlights the importance of XBP1 in myeloma and its significance as an independent prognostic marker and as a predictor of thalidomide response
20368688 RT-PCR experiments revealed increased splicing of X-box binding protein-1 (XBP-1), an UPR transcription factor, in AD compared with age-matched control.
20170659 X-box binding protein 1 regulates brain natriuretic peptide through a novel AP1/CRE-like element in cardiomyocytes
20013084 Data conclude that IRE1alpha activity controls a subset of the ER stress response and mediates proliferation through tight control of Xbp-1 splicing.
19958799 Here, we show a decrease in heterologous human XBP-1(s) expression in CHO production cells producing a therapeutic antibody product monitored over a prolonged period in serial culture.
19941857 direct proteasomal degradation of XBP-1u prevents its intracellular aggregation.
19751410 XBP1 protein expression is induced in the liver by a high carbohydrate diet and directly controls the induction of critical genes involved in fatty acid synthesis.
19735688 polymorphisms studied in the PRDM1 and XBP1 genes do not seem to be involved in immunoglobulin A deficiency predisposition in the Spanish population.
19735688 Observational study of gene-disease association. (HuGE Navigator)
19722195 Data show that GRP78 was upregulated following treatment with NAC or PEN, and both the ATF6 protein and XBP1 mRNA were processed, which facilitates the expression of C/EBP homologous protein CHOP.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19669932 The prevalence of XBP1 gene (-116 C/G) polymorphism, separately among the patients with atherosclerosis, ischemic stroke and hyperhomocysteinemia, was investigated.
19669932 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19622636 Unconventional splicing of XBP1 mRNA occurs predominantly in the cytoplasm.
19609461 Discusses the role of XBP1 as a prosurvival factor in breast and other cancers, and its potential as a druggable target.
19564049 the patients with the G allele of XBP1-116C/G showed a better prophylactic treatment response to valproate compared to the C allele.
19564049 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19543371 Transcriptional modulation of XBP1 expression by a germ-line regulatory polymorphism has an impact on the development of vitiligo.
19543371 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19530237 Data provide evidence that hsa-miR-127 is involved in B-cell differentiation process through posttranscriptional regulation of BLIMP1 and XBP1.
19470730 The formation of the spliced variant of XBP1s was detectable in 16.2% of AML patients, and consistent with activated unfolded protein response, thess patients also had significantly increased expression of calreticulin, GRP78, and CHOP.
19435892 XBP-1 significantly correlates with Epstein-Barr virus LMP1 expression in nasopharyngeal tumor biopsies.
19420237 ATF6alpha induces XBP1-independent expansion of the endoplasmic reticulum.
19416856 In umbilical vein endothelial cells, disturbed flow increased the activation of XBP1 expression and splicing. Overexpression of spliced XBP1 induced apoptosis of HUVECs and endothelial loss from blood vessels
19412428 these results identify activation of the PI3K/Akt pathway by XBP-1-mediated signaling of the unfolded protein response as a resistance mechanism against docetaxel and vincristine in melanoma cells under ER stress.
19403667 XBP-1 transactivates the viral ORF50/RTA promoter though an ACGT core containing the XBP-1 response element.
19389935 Xbp-1 activation may play a role in the pathogenesis of aggressive B-cell lymphomas.
19380033 novel missense mutation of the X-box-binding protein 1 gene in diffuse large B-cell lymphoma
19321437 XBP-1s is responsible for the ER/Ca(2+) store expansion that confers amplification of Ca(2+)-dependent inflammatory responses.
19265690 p38/XBP-1 signaling negatively regulated ERp29 expression in BT549 breast cancer cells
19237300 genetic polymorphisms are associated with inflammatory bowel disease
19176362 XBP1(S) expression delineates heterogeneity amongst plasmablastic diffuse large B-cell lymphomas, identifying a distinct tumor sub-group.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19154631 In this study among 132 adults (mean age 39 yr) who presented with a major depressive episode, this polymorphism was found to be associated with a worse course during 1-yr prospective follow-up. and also with higher plasma levels.
19154631 Observational study of gene-disease association. (HuGE Navigator)
19122331 pXBP1(U) functions as a negative regulator of the unfolded protein response-specific transcription factors ATF6 and pXBP1(S).
19112081 Discovered a novel topological feature of signaling in breast cancer cells that links XBP1 to NFkB and BCL2 in response to estrogen and antiestrogen treatment.
19009018 Neurons exposed to HIV-1 Tat induces calcium loss from the endoplasmic reticulum via ryanodine receptor (RyR) and increases the phosphorylated levels of PERK, eIF2a, and XBP1
18840627 the -116C/G genotype may be a risk factor for at least pediatric obesity
18840627 Observational study of gene-disease association. (HuGE Navigator)
18840095 Transcriptional induction of the human asparagine synthetase gene during the unfolded protein response does not require the XBP1.
18775308 An association of XBP1 variants with both forms of human IBD (Crohn's disease and ulcerative colitis) was identified and replicated (rs35873774; p value 1.6 x 10(-5)) with novel, private hypomorphic variants identified as susceptibility factors.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18635891 Compared with COPD and donor lungs, protein levels of ER stress mediators, such as ATF-6 and ATF-4 and the apoptosis-inductor CHOP as well as XBP-1, were significantly elevated in lung homogenates and AECIIs of IPF lungs
18583979 Meta-analysis of gene-disease association. (HuGE Navigator)
18552212 By chromatin immunoprecipitation and assays using an inducible Spi-B construct BLIMP1 and XBP-1 were identified as direct target genes of Spi-B mediated repression.
18417469 Xbp1-responsive OS-9 variants in the mammalian endoplasmic reticulum inhibit secretion of misfolded protein conformers and enhancing their disposal
18386815 Findings, that XBP-1 isoforms are differently associated with outcome of endocrine therapy for patients, can be explained by higher levels of dominant-negative XBP-1U favouring apoptosis of tumor cells and higher levels of XBP-1S increasing tumor survival
18192112 that transcription factors Xbp-1, Blimp-1, and PAX-5-encoded BSAP play important roles in the regulation of plasmacytic differentiation and exert their effects on differentiation induced by low 2ME2 concentrations
18082745 Nonalcoholic steatohepatitis is specifically associated with (1) failure to generate sXBP-1 protein and (2) activation of JNK.
17932454 XBP1 polymorphism (-116C/G) is not involved in susceptibility to suicide.
17932454 Observational study of gene-disease association. (HuGE Navigator)
17928342 XBP-1s binds to and activates the KSHV immediate-early gene ORF50.
17906960 When islets were cultured for 24 h at 11.1 mmol/l glucose, there was induction of BiP and XBP-1 in type 2 diabetes islets but not in non-diabetic islets.
17898050 We report that the plasma cell differentiation factor, XBP-1s, activates the expression of the master regulator of EBV lytic activation, BZLF1.
17884689 XBP1 gene promoter can drive its downstream gene expression and its activity is cell line-dependent.
17660348 Overexpression of spliced XBP1 prevents cell cycle arrest and antiestrogen-induced cell death through the mitochondrial apoptotic pathway.
17660348 XBP1 and the unfolded protein response modulate responsiveness to estrogens and antiestrogens in breast cancer.
17442311 Misoxidised MHC class I heavy chains activate XBP1 processing in a similar manner to tunicamycin.
17418411 Overexpression of XBP-1 is associated with multiple myeloma pathogenesis
17092596 Our results clearly establish HBx as an inducer of UPR and the activator of the ATF6 and IRE1-XBP1 pathways of UPR.
17026957 XBP1 splicing can occur in the cytoplasm, and that cleavage and ligation of XBP1 mRNA during splicing may occur as a coupled reaction.
16958950 Observational study of gene-disease association. (HuGE Navigator)
16461360 The swift adapting to physiological changes in the endoplasmic reticulum was studied which required the interplay between XBP1(unspliced) and XBP1 (spliced).
16461360 XBP1 pre-mRNA encodes a negative feed-back regulator of ER stress response
16342282 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16342282 The functional XBP1 gene polymorphism is not of major importance to schizophrenia in the European populations investigated.
16327981 Describes correlations of XBP1 with IRF1 and NFkB in a tissue microarray study of breast tumors from patients; data analyzed using partial correlation coefficients.
16154272 Observational study of gene-disease association. (HuGE Navigator)
16154272 The present results suggested that the XBP1 gene polymorphism was associated with the NEO-FFI score of neuroticism in female subjects.
16002735 Transcriptional regulator XBP-1 governing B-cell terminal cellular differentiation provides multiple myeloma-and other tumor- and nonmalignant-associated cytotoxic T-lymphocyte epitopes.
15936534 Observational study of gene-disease association. (HuGE Navigator)
15927087 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15892135 Observational study of gene-disease association. (HuGE Navigator)
15882996 results reveal a target sequence for the IRE1-XBP1 pathway under ER stress conditions
15598891 ATF6 and XBP1 have roles in activation of endoplasmic reticulum stress-responsive cis-acting elements
15380296 Observational study of gene-disease association. (HuGE Navigator)
15351732 XBP-1 has a role in ERalpha transcriptional activity through regulation of large-scale chromatin unfolding
15331160 Observational study of gene-disease association. (HuGE Navigator)
15298659 Observational study of gene-disease association. (HuGE Navigator)
15184063 Observational study of gene-disease association. (HuGE Navigator)
15184063 Data suggest that -197C/G in XBP1 is also a genetic risk factor for schizophrenia, and presents a sex-dependent genetic effect for the disorder.
15063770 By subjecting dermal fibroblasts to multiple stresses, strong correlations were found between ATF6 activation and XBP1 splicing, and between GRP78/BiP mRNA and EDEM mRNA accumulation.
14634507 increased expression of the hXBP-1 gene may play some role in human breast carcinogenesis through impairment of cell differentiation regulation
14576841 XBP-1 is implicated in a gene network that regulates estrogen receptor signaling in breast cancer
12949534 Impaired feedback regulaton of this protein is a genetic risk factor for bipolar disorder.
12713871 The endoplasmic reticulum stress pathway mediated by ATF6 and by IRE1-XBP1 systems seems essential for the transformation-associated expression of the grp78 gene in hepatocarcinogenesis
12586069 XBP1 and ATF6 jointly regulate mammalian ER stress response
12067985 XBP-1 and activation of cAMP response elements expression are upregulated in acquired antiestrogen resistance in breast cancer cells
11813207 down-regulation of expression correlate with prostate adenocarcinoma progression
11779464 XBP1 is a key regulator of mammalian ER stress response

AA Sequence

MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPE      1 - 70
EKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMD     71 - 140
ALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTT    141 - 210
WTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN                       211 - 261
//

Text Mined References (201)

PMID Year Title
26742428 2016 Activation of IRE1?-XBP1 pathway induces cell proliferation and invasion in colorectal carcinoma.
26680227 2016 XBP1 silencing decreases glioma cell viability and glycolysis possibly by inhibiting HK2 expression.
26633383 2015 Overexpression of X-Box Binding Protein 1 (XBP1) Correlates to Poor Prognosis and Up-Regulation of PI3K/mTOR in Human Osteosarcoma.
26517687 2015 A novel chemical, STF-083010, reverses tamoxifen-related drug resistance in breast cancer by inhibiting IRE1/XBP1.
26491160 2015 Induction of Kaposi's Sarcoma-Associated Herpesvirus-Encoded Viral Interleukin-6 by X-Box Binding Protein 1.
26483401 2015 A conformational RNA zipper promotes intron ejection during non-conventional XBP1 mRNA splicing.
26469762 2015 The IRE1?/XBP1s Pathway Is Essential for the Glucose Response and Protection of ? Cells.
26331676 2015 X-Box-Binding Protein 1 and Innate Immune Responses of Human Cystic Fibrosis Alveolar Macrophages.
26299655 2016 Polymorphism - 116C/G of the human X box binding protein 1 gene is associated with risk of type 2 diabetes in a Chinese Han population.
26134873 2015 RITA enhances irradiation-induced apoptosis in p53-defective cervical cancer cells via upregulation of IRE1?/XBP1 signaling.
26112372 2015 The fibroblast expression of RANKL in CoCrMo-particle-induced osteolysis is mediated by ER stress and XBP1s.
26073941 2015 ER Stress Sensor XBP1 Controls Anti-tumor Immunity by Disrupting Dendritic Cell Homeostasis.
25993558 2015 A functional link between the co-translational protein translocation pathway and the UPR.
25986851 2015 Targeting the IRE1?-XBP1 branch of the unfolded protein response in human diseases.
25901709 2015 RACK1 modulates apoptosis induced by sorafenib in HCC cells by interfering with the IRE1/XBP1 axis.
25870107 2015 Cleavage of BLOC1S1 mRNA by IRE1 Is Sequence Specific, Temporally Separate from XBP1 Splicing, and Dispensable for Cell Viability under Acute Endoplasmic Reticulum Stress.
25754093 2015 Defective podocyte insulin signalling through p85-XBP1 promotes ATF6-dependent maladaptive ER-stress response in diabetic nephropathy.
25692573 2015 X-box binding protein 1 (XBP-1) enhances colorectal cancer cell invasion.
25656649 2015 MicroRNA-214 Is Upregulated in Heart Failure Patients and Suppresses XBP1-Mediated Endothelial Cells Angiogenesis.
25633224 2015 The short-chain fatty acid receptor GPR43 is transcriptionally regulated by XBP1 in human monocytes.
25633195 2015 Imaging of single cell responses to ER stress indicates that the relative dynamics of IRE1/XBP1 and PERK/ATF4 signalling rather than a switch between signalling branches determine cell survival.
25450523 2015 Expression of citrate carrier gene is activated by ER stress effectors XBP1 and ATF6?, binding to an UPRE in its promoter.
25448679 2014 Reactive oxygen species increase HEPN1 expression via activation of the XBP1 transcription factor.
25437541 2014 Ire1 has distinct catalytic mechanisms for XBP1/HAC1 splicing and RIDD.
25426559 2015 GCN5 inhibits XBP-1S-mediated transcription by antagonizing PCAF action.
25378478 2014 The mammalian tRNA ligase complex mediates splicing of XBP1 mRNA and controls antibody secretion in plasma cells.
25280941 2015 XBP1 induces snail expression to promote epithelial- to-mesenchymal transition and invasion of breast cancer cells.
25239945 2014 Signal peptide peptidase functions in ERAD to cleave the unfolded protein response regulator XBP1u.
25231123 2014 The -116C/G polymorphism in XBP1 gene is associated with psychiatric illness in Asian population: A meta-analysis.
25216212 2015 Involvement of the IRE1?-XBP1 pathway and XBP1s-dependent transcriptional reprogramming in metabolic diseases.
25190803 2014 Unspliced X-box-binding protein 1 (XBP1) protects endothelial cells from oxidative stress through interaction with histone deacetylase 3.
25170079 2014 Fibroblast growth factor 21 is regulated by the IRE1?-XBP1 branch of the unfolded protein response and counteracts endoplasmic reticulum stress-induced hepatic steatosis.
25129146 2014 Joint analysis of three genome-wide association studies of esophageal squamous cell carcinoma in Chinese populations.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24909686 2014 Involvement of transcription factor XBP1s in the resistance of HDAC6 inhibitor Tubastatin A to superoxidation via acetylation-mediated proteasomal degradation.
24821775 2014 Mechanistic rationale for targeting the unfolded protein response in pre-B acute lymphoblastic leukemia.
24762547 2014 In vivo intratumoral Epstein-Barr virus replication is associated with XBP1 activation and early-onset post-transplant lymphoproliferative disorders with prognostic implications.
24670641 2014 XBP1 promotes triple-negative breast cancer by controlling the HIF1? pathway.
24497562 2014 High XBP1 expression is a marker of better outcome in multiple myeloma patients treated with bortezomib.
24387801 2014 TLR dependent XBP-1 activation induces an autocrine loop in rheumatoid arthritis synoviocytes.
24356728 2015 Unfolded protein response inducers tunicamycin and dithiothreitol promote myeloma cell differentiation mediated by XBP-1.
24269637 2014 ATF6 upregulates XBP1S and inhibits ER stress-mediated apoptosis in osteoarthritis cartilage.
24194940 2013 Endoplasmic reticulum stress, unfolded protein response and altered T cell differentiation in necrotizing enterocolitis.
24165480 2014 Unfolded protein response signaling by transcription factor XBP-1 regulates ADAM10 and is affected in Alzheimer's disease.
24029229 2013 Xbp1s-negative tumor B cells and pre-plasmablasts mediate therapeutic proteasome inhibitor resistance in multiple myeloma.
24027308 2013 Epstein-Barr virus induces global changes in cellular mRNA isoform usage that are important for the maintenance of latency.
23930139 2011 Endoplasmic reticulum stress, the unfolded protein response, and gene network modeling in antiestrogen resistant breast cancer.
23737521 2013 Identification of a novel endoplasmic reticulum stress response element regulated by XBP1.
23560553 2013 Multiple myeloma Leu167Ile (c.499C>A) mutation prevents XBP1 mRNA splicing.
23529610 2013 Vascular endothelial cell growth-activated XBP1 splicing in endothelial cells is crucial for angiogenesis.
23510626 2013 XBP1 promoter polymorphism modulates platinum-based chemotherapy gastrointestinal toxicity for advanced non-small cell lung cancer patients.
23470653 2013 UBC9 regulates the stability of XBP1, a key transcription factor controlling the ER stress response.
23447676 2013 ER-stress-associated functional link between Parkin and DJ-1 via a transcriptional cascade involving the tumor suppressor p53 and the spliced X-box binding protein XBP-1.
23421912 2013 Polymorphism -116C/G of human X-box-binding protein 1 promoter is associated with risk of Alzheimer's disease.
23335490 A CHO cell line engineered to express XBP1 and ERO1-L? has increased levels of transient protein expression.
23277279 2013 XBP-1u suppresses autophagy by promoting the degradation of FoxO1 in cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184933 2013 XBP1 mRNA splicing triggers an autophagic response in endothelial cells through BECLIN-1 transcriptional activation.
22960999 2012 Genome-wide association analyses of esophageal squamous cell carcinoma in Chinese identify multiple susceptibility loci and gene-environment interactions.
22934019 2012 The endoplasmic reticulum stress response in aging and age-related diseases.
22925926 2012 High rate of antibody secretion is not integral to plasma cell differentiation as revealed by XBP-1 deficiency.
22787145 2012 SLC33A1/AT-1 protein regulates the induction of autophagy downstream of IRE1/XBP1 pathway.
22679299 2012 Involvement of X-box binding protein 1 and reactive oxygen species pathways in the pathogenesis of tumour necrosis factor receptor-associated periodic syndrome.
22669460 2012 XBP1S protects cells from ER stress-induced apoptosis through Erk1/2 signaling pathway involving CHOP.
22644804 2012 PI3K/Akt pathway mediates high glucose-induced lipid accumulation in human renal proximal tubular cells via spliced XBP-1.
22469468 2012 Inhibition of enterovirus 71 entry by transcription factor XBP1.
22445760 2012 AAV-mediated delivery of the transcription factor XBP1s into the striatum reduces mutant Huntingtin aggregation in a mouse model of Huntington's disease.
22427205 2012 Expression of XBP1s in bone marrow stromal cells is critical for myeloma cell growth and osteoclast formation.
22422988 2012 Endoplasmic reticulum stress, the unfolded protein response, autophagy, and the integrated regulation of breast cancer cell fate.
22370484 2012 SENP1 deficiency promotes ER stress-induced apoptosis by increasing XBP1 SUMOylation.
22013210 2011 The unfolded protein response: integrating stress signals through the stress sensor IRE1?.
22002058 2011 The unfolded protein response (UPR)-activated transcription factor X-box-binding protein 1 (XBP1) induces microRNA-346 expression that targets the human antigen peptide transporter 1 (TAP1) mRNA and governs immune regulatory genes.
21924241 2011 Function of yeast and amphioxus tRNA ligase in IRE1alpha-dependent XBP1 mRNA splicing.
21858728 2011 Relationships of ESR1 and XBP1 expression in human breast carcinoma and stromal cells isolated by laser capture microdissection compared to intact breast cancer tissue.
21677677 2011 Dynamic modelling of oestrogen signalling and cell fate in breast cancer cells.
21660045 2011 Identification of novel myeloma-specific XBP1 peptides able to generate cytotoxic T lymphocytes: a potential therapeutic application in multiple myeloma.
21423203 2011 Ets-1 mediates upregulation of Mcl-1 downstream of XBP-1 in human melanoma cells upon ER stress.
21385877 2011 Dengue virus modulates the unfolded protein response in a time-dependent manner.
21233347 2011 Translational pausing ensures membrane targeting and cytoplasmic splicing of XBP1u mRNA.
21138840 2011 Preconditioning with endoplasmic reticulum stress mitigates retinal endothelial inflammation via activation of X-box binding protein 1.
21138464 2011 Targeting X box-binding protein-1 (XBP1) enhances sensitivity of glioma cells to oxidative stress.
21129257 2010 [Influence of different spliceosomes of overexpressed XBP-1 on differentiation of myeloma cells].
21129256 2010 [Effects of xbp-1 gene silencing on bortezomib-induced apoptosis in human multiple myeloma cells].
21085187 2011 Comprehensive association analysis of candidate genes for generalized vitiligo supports XBP1, FOXP3, and TSLP.
21061914 2010 Emerging roles for XBP1, a sUPeR transcription factor.
21050047 2010 Novel immunohistochemical monoclonal antibody against human XBP-1.
20980528 2011 X-box binding protein 1 induces the expression of the lytic cycle transactivator of Kaposi's sarcoma-associated herpesvirus but not Epstein-Barr virus in co-infected primary effusion lymphoma.
20955178 2011 Regulation of unfolded protein response modulator XBP1s by acetylation and deacetylation.
20688044 2010 The HPV-16 E5 protein represses expression of stress pathway genes XBP-1 and COX-2 in genital keratinocytes.
20421453 2010 XBP1s levels are implicated in the biology and outcome of myeloma mediating different clinical outcomes to thalidomide-based treatments.
20368688 2010 Induction of the unfolded protein response and cell death pathway in Alzheimer's disease, but not in aged Tg2576 mice.
20348923 2010 A regulatory subunit of phosphoinositide 3-kinase increases the nuclear accumulation of X-box-binding protein-1 to modulate the unfolded protein response.
20170659 2010 X-box binding protein 1 regulates brain natriuretic peptide through a novel AP1/CRE-like element in cardiomyocytes.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
20013084 2010 IRE1alpha controls cyclin A1 expression and promotes cell proliferation through XBP-1.
19958799 2010 Evaluation of a combinatorial cell engineering approach to overcome apoptotic effects in XBP-1(s) expressing cells.
19941857 2010 Direct proteasome binding and subsequent degradation of unspliced XBP-1 prevent its intracellular aggregation.
19751410 2009 From sugar to fat: How the transcription factor XBP1 regulates hepatic lipogenesis.
19735688 2009 Lack of evidence of a role of XBP1 and PRDM1 polymorphisms in Spanish patients with immunoglobulin A deficiency.
19722195 2010 N-acetyl cysteine and penicillamine induce apoptosis via the ER stress response-signaling pathway.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19669932 2010 Relationship between functional promoter polymorphism in the XBP1 gene (-116C/G) and atherosclerosis, ischemic stroke and hyperhomocysteinemia.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19622636 2009 Unconventional splicing of XBP1 mRNA occurs in the cytoplasm during the mammalian unfolded protein response.
19609461 2009 The role of X-box binding protein-1 in tumorigenicity.
19564049 2009 Preliminary evidence on the association between XBP1-116C/G polymorphism and response to prophylactic treatment with valproate in bipolar disorders.
19543371 2009 Genetic variation of promoter sequence modulates XBP1 expression and genetic risk for vitiligo.
19530237 2010 B-cell differentiation in EBV-positive Burkitt lymphoma is impaired at posttranscriptional level by miRNA-altered expression.
19470730 2009 Activation of the unfolded protein response is associated with favorable prognosis in acute myeloid leukemia.
19435892 2009 Endoplasmic reticulum stress triggers XBP-1-mediated up-regulation of an EBV oncoprotein in nasopharyngeal carcinoma.
19420237 2009 ATF6alpha induces XBP1-independent expansion of the endoplasmic reticulum.
19416856 2009 Sustained activation of XBP1 splicing leads to endothelial apoptosis and atherosclerosis development in response to disturbed flow.
19412428 2009 Human melanoma cells under endoplasmic reticulum stress acquire resistance to microtubule-targeting drugs through XBP-1-mediated activation of Akt.
19403667 2009 X-box binding protein 1 contributes to induction of the Kaposi's sarcoma-associated herpesvirus lytic cycle under hypoxic conditions.
19394296 2009 Cotranslational targeting of XBP1 protein to the membrane promotes cytoplasmic splicing of its own mRNA.
19389935 2009 Activation of the endoplasmic reticulum stress-associated transcription factor x box-binding protein-1 occurs in a subset of normal germinal-center B cells and in aggressive B-cell lymphomas with prognostic implications.
19380033 2009 A novel missense mutation of the XBP1 gene in diffuse large B-cell lymphoma.
19321437 2009 Airway epithelial inflammation-induced endoplasmic reticulum Ca2+ store expansion is mediated by X-box binding protein-1.
19265690 2009 Cytokeratin 19 regulates endoplasmic reticulum stress and inhibits ERp29 expression via p38 MAPK/XBP-1 signaling in breast cancer cells.
19237300 2009 Endoplasmic reticulum stress in the intestinal epithelium and inflammatory bowel disease.
19176362 2009 Expression pattern of XBP1(S) in human B-cell lymphomas.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19154631 2009 Association of X-box binding protein 1 ( XBP1) genotype with morning cortisol and 1-year clinical course after a major depressive episode.
19135031 2009 Protective effect against Parkinson's disease-related insults through the activation of XBP1.
19122331 2009 pXBP1(U), a negative regulator of the unfolded protein response activator pXBP1(S), targets ATF6 but not ATF4 in proteasome-mediated degradation.
19112081 2009 Differential dependency network analysis to identify condition-specific topological changes in biological networks.
18840627 2010 Relationship between functional promoter polymorphism in the XBP1 gene (-116C/G) and obesity.
18840095 2009 Transcriptional induction of the human asparagine synthetase gene during the unfolded protein response does not require the ATF6 and IRE1/XBP1 arms of the pathway.
18775308 2008 XBP1 links ER stress to intestinal inflammation and confers genetic risk for human inflammatory bowel disease.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18635891 2008 Epithelial endoplasmic reticulum stress and apoptosis in sporadic idiopathic pulmonary fibrosis.
18583979 2008 Systematic meta-analyses and field synopsis of genetic association studies in schizophrenia: the SzGene database.
18552212 2008 Spi-B inhibits human plasma cell differentiation by repressing BLIMP1 and XBP-1 expression.
18417469 2008 A dual task for the Xbp1-responsive OS-9 variants in the mammalian endoplasmic reticulum: inhibiting secretion of misfolded protein conformers and enhancing their disposal.
18386815 2008 Expression and splicing of the unfolded protein response gene XBP-1 are significantly associated with clinical outcome of endocrine-treated breast cancer.
18192112 2007 Transcription factors Xbp-1, Blimp-1, and BSAP are involved in the regulation of plasmacytic differentiation induced by 2-methoxyestradiol in myeloma cell lines.
18082745 2008 Activation and dysregulation of the unfolded protein response in nonalcoholic fatty liver disease.
17932454 2007 Lack of association between endoplasmic reticulum stress response genes and suicidal victims.
17928342 2007 X box binding protein XBP-1s transactivates the Kaposi's sarcoma-associated herpesvirus (KSHV) ORF50 promoter, linking plasma cell differentiation to KSHV reactivation from latency.
17906960 2007 The endoplasmic reticulum in pancreatic beta cells of type 2 diabetes patients.
17898050 2007 Plasma cell-specific transcription factor XBP-1s binds to and transactivates the Epstein-Barr virus BZLF1 promoter.
17884689 2007 Study of transcription activity of X-box binding protein 1 gene in human different cell lines.
17765680 2007 Transcriptional induction of mammalian ER quality control proteins is mediated by single or combined action of ATF6alpha and XBP1.
17660348 2007 Human X-box binding protein-1 confers both estrogen independence and antiestrogen resistance in breast cancer cell lines.
17442311 2007 Activation of the unfolded protein response and alternative splicing of ATF6alpha in HLA-B27 positive lymphocytes.
17418411 2007 The differentiation and stress response factor XBP-1 drives multiple myeloma pathogenesis.
17224074 2007 Somatic sequence alterations in twenty-one genes selected by expression profile analysis of breast carcinomas.
17110785 2006 XBP1 is critical to protect cells from endoplasmic reticulum stress: evidence from Site-2 protease-deficient Chinese hamster ovary cells.
17092596 2007 Hepatitis B virus X protein (HBx) activates ATF6 and IRE1-XBP1 pathways of unfolded protein response.
17034899 2006 Functionality of unspliced XBP1 is required to explain evolution of overlapping reading frames.
17026957 2006 Analysis of the XBP1 splicing mechanism using endoplasmic reticulum stress-indicators.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16958950 2006 Association study of a functional promoter polymorphism of the X-box binding protein 1 gene in Japanese patients with schizophrenia.
16645094 2006 Proapoptotic BAX and BAK modulate the unfolded protein response by a direct interaction with IRE1alpha.
16461360 2006 pXBP1(U) encoded in XBP1 pre-mRNA negatively regulates unfolded protein response activator pXBP1(S) in mammalian ER stress response.
16381901 2006 The LIFEdb database in 2006.
16342282 2006 Association study of a functional promoter polymorphism in the XBP1 gene and schizophrenia.
16327981 2006 Expression patterns among interferon regulatory factor-1, human X-box binding protein-1, nuclear factor kappa B, nucleophosmin, estrogen receptor-alpha and progesterone receptor proteins in breast cancer tissue microarrays.
16154272 2005 Relationship between XBP1 genotype and personality traits assessed by TCI and NEO-FFI.
16002735 2005 Targeting positive regulatory domain I-binding factor 1 and X box-binding protein 1 transcription factors by multiple myeloma-reactive CTL.
15936534 2005 The X-box binding protein 1 (XBP1) gene is not associated with methamphetamine dependence.
15927087 2006 A possible association between the -116C/G single nucleotide polymorphism of the XBP1 gene and lithium prophylaxis in bipolar disorder.
15892135 2005 XBP1 gene polymorphism (-116C/G) and personality.
15882996 2005 XBP1 activates the transcription of its target genes via an ACGT core sequence under ER stress.
15598891 2004 Differential contributions of ATF6 and XBP1 to the activation of endoplasmic reticulum stress-responsive cis-acting elements ERSE, UPRE and ERSE-II.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466483 2004 XBP1: a link between the unfolded protein response, lipid biosynthesis, and biogenesis of the endoplasmic reticulum.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15380296 2004 Lack of association between XBP1 genotype and calcium signaling in the platelets of healthy subjects.
15351732 2004 XBP-1 increases ERalpha transcriptional activity through regulation of large-scale chromatin unfolding.
15331160 2004 X-box binding protein 1 (XBP1) C--116G polymorphisms in bipolar disorders and age of onset.
15298659 2004 Association of the XBP1-116C/G polymorphism with schizophrenia in the Japanese population.
15184063 2004 A case-control study provides evidence of association for a functional polymorphism -197C/G in XBP1 to schizophrenia and suggests a sex-dependent effect.
15149721 2004 About GATA3, HNF3A, and XBP1, three genes co-expressed with the oestrogen receptor-alpha gene (ESR1) in breast cancer.
15063770 2004 Discordance of UPR signaling by ATF6 and Ire1p-XBP1 with levels of target transcripts.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14634507 2003 Upregulation and overexpression of human X-box binding protein 1 (hXBP-1) gene in primary breast cancers.
14576841 2003 Antiestrogen resistance in breast cancer and the role of estrogen receptor signaling.
12954762 2003 Ligand-independent activation of estrogen receptor alpha by XBP-1.
12949534 2003 Impaired feedback regulation of XBP1 as a genetic risk factor for bipolar disorder.
12805554 2003 Comprehensive identification of human bZIP interactions with coiled-coil arrays.
12713871 2003 Activation of the ATF6, XBP1 and grp78 genes in human hepatocellular carcinoma: a possible involvement of the ER stress pathway in hepatocarcinogenesis.
12586069 2003 A time-dependent phase shift in the mammalian unfolded protein response.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12067985 2002 Association of interferon regulatory factor-1, nucleophosmin, nuclear factor-kappaB, and cyclic AMP response element binding with acquired resistance to Faslodex (ICI 182,780).
11779464 2001 XBP1 mRNA is induced by ATF6 and spliced by IRE1 in response to ER stress to produce a highly active transcription factor.
11460154 2001 Plasma cell differentiation requires the transcription factor XBP-1.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10652269 2000 An essential role in liver development for transcription factor XBP-1.
10591208 1999 The DNA sequence of human chromosome 22.
10375612 1999 Identification of c-myc promoter-binding protein and X-box binding protein 1 as interleukin-6 target genes in human multiple myeloma cells.
9563853 1998 Enhanced expression of a new class of liver-enriched b-Zip transcription factors, hepatocarcinogenesis-related transcription factor, in hepatocellular carcinomas of rats and humans.
8657566 1996 The basic domain/leucine zipper protein hXBP-1 preferentially binds to and transactivates CRE-like sequences containing an ACGT core.
8627152 1996 Transcription factor B cell lineage-specific activator protein regulates the gene for human X-box binding protein 1.
8349596 1993 The regulatory gene, hXBP-1, and its target, HLA-DRA, utilize both common and distinct regulatory elements and protein complexes.
2321018 1990 A new member of the leucine zipper class of proteins that binds to the HLA DR alpha promoter.
2196176 1990 Multiple cDNA clones encoding nuclear proteins that bind to the tax-dependent enhancer of HTLV-1: all contain a leucine zipper structure and basic amino acid domain.
1903538 1991 Human X-box-binding protein 1 is required for the transcription of a subset of human class II major histocompatibility genes and forms a heterodimer with c-fos.
1718857 1991 An HLA-DR alpha promoter DNA-binding protein is expressed ubiquitously and maps to human chromosomes 22 and 5.