Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.03
PubTator Score 1.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Malignant neoplasm of prostate 67
Disease Target Count Z-score Confidence
Hydrocele 8 3.97 2.0
Inguinal hernia 13 3.348 1.7

AA Sequence

MIWRGRSTYRPRPRRSVPPPELIGPMLEPGDEEPQQEEPPTESRDPAPGQEREEDQGAAETQVPDLEADL      1 - 70
QELSQSKTGGECGNGPDDQGKILPKSEQFKMPEGGDRQPQV                                  71 - 111
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11992404 2002 The XAGE family of cancer/testis-associated genes: alignment and expression profile in normal tissues, melanoma lesions and Ewing's sarcoma.
10197611 1999 Novel genes in the PAGE and GAGE family of tumor antigens found by homology walking in the dbEST database.