Property Summary

NCBI Gene PubMed Count 29
PubMed Score 24.10
PubTator Score 39.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count
Adenoid Cystic Carcinoma 99

Gene RIF (8)

PMID Text
26937656 Strong immune responses to the cancer testis antigen XAGE-1b have been found in non-small cell lung cancer Caucasian patients.
24304136 Data indicate the involvement of immunoglobulin allotypes immunoglobulin gamma and kappa chains in immunity to a cancer-testis antigen, which has important implications for XAGE-1b-based immunotherapeutic interventions in lung adenocarcinoma.
24008415 XAGE-1b gene was able to influence angiogenesis directly or indirectly, leading to tumorigenesis and metastasis of ACC.
23625514 Our results suggest that GAGE, XAGE1 and SSX4 might each have a role in melanoma progression
20178013 the XAGE-1b gene was expressed at the mRNA level in a proportion of human acute leukemia
18752338 The findings suggest that XAGE-1b and HLA class I expression elicited a CD8+ T-cell response against minimal residual disease after surgery and resulted in prolonged survival of non-small cell lung cancer patients.
17704638 A 12-mer peptide XAGE-1b(37-48) as a new XAGE-1b epitope restricted to HLA-DRB1*0410 was identified.
17332921 Recognition of XAGE-1b on OU-LU-6 tumor by the CD4-expressing tumor-infiltrating lymphocytes was studied.

AA Sequence

MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCK      1 - 70
MPEAGEEQPQV                                                                71 - 81
//

Text Mined References (32)

PMID Year Title
26937656 2016 Immune Responses to the Cancer Testis Antigen XAGE-1b in Non Small Cell Lung Cancer Caucasian Patients.
25416956 2014 A proteome-scale map of the human interactome network.
24304136 2014 Genetic variants of immunoglobulin ? and ? chains influence humoral immunity to the cancer-testis antigen XAGE-1b (GAGED2a) in patients with non-small cell lung cancer.
24008415 2013 Promoting effects on the proliferation and metastasis of ACC tumor cell with XAGE-1b overexpression.
23625514 2013 Effects of CT-Xp gene knock down in melanoma cell lines.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21413013 2012 Heteroclitic serological response in esophageal and prostate cancer patients after NY-ESO-1 protein vaccination.
21305256 2011 NLS-dependent and insufficient nuclear localization of XAGE-1 splice variants.
20704819 2010 [Association of XAGE-1 gene expression with clinical characteristics of lung cancer].
20178013 2010 mRNA expression of the XAGE-1 gene in human acute leukemia.
19498007 2009 Epigenetic modulation of cancer-germline antigen gene expression in tumorigenic human mesenchymal stem cells: implications for cancer therapy.
18803763 2008 A dendritic cell-based tumour vaccine for lung cancer: full-length XAGE-1b protein-pulsed dendritic cells induce specific cytotoxic T lymphocytes in vitro.
18752338 2008 Prolonged survival of patients with lung adenocarcinoma expressing XAGE-1b and HLA class I antigens.
18045611 2008 Identification of prostate cancer antigens by automated high-throughput filter immunoscreening.
17704638 2007 HLA-DRB1*0410-restricted recognition of XAGE-1b37-48 peptide by CD4 T cells.
17666327 2007 [Association of XAGE-1b gene expression with clinical characteristics of non-small cell lung cancer].
17335148 2007 Identification of XAGE-1 isoforms: predominant expression of XAGE-1b in testis and tumors.
17332921 2007 Identification of DR9-restricted XAGE antigen on lung adenocarcinoma recognized by autologous CD4 T-cells.
16715135 2006 Epigenetic regulation of X-linked cancer/germline antigen genes by DNMT1 and DNMT3b.
16468707 2006 Characterization of preexisting humoral immunity specific for two cancer-testis antigens overexpressed at the mRNA level in non-small cell lung cancer.
16061866 2005 XAGE-1 expression in non-small cell lung cancer and antibody response in patients.
15905609 2005 XAGE-1 mRNA expression in prostate cancer and antibody response in patients.
15800911 2005 Activation of human cancer/testis antigen gene, XAGE-1, in tumor cells is correlated with CpG island hypomethylation.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14747957 2004 Serological cloning of cancer/testis antigens expressed in prostate cancer using cDNA phage surface display.
14696120 2004 Immunoscreening of a cDNA library from a lung cancer cell line using autologous patient serum: Identification of XAGE-1b as a dominant antigen and its immunogenicity in lung adenocarcinoma.
12479262 2002 Characterization of overlapping XAGE-1 transcripts encoding a cancer testis antigen expressed in lung, breast, and other types of cancers.
11992404 2002 The XAGE family of cancer/testis-associated genes: alignment and expression profile in normal tissues, melanoma lesions and Ewing's sarcoma.
11774264 2002 Characterization of XAGE-1b, a short major transcript of cancer/testis-associated gene XAGE-1, induced in melanoma metastasis.
10987281 2000 XAGE-1, a new gene that is frequently expressed in Ewing's sarcoma.
10197611 1999 Novel genes in the PAGE and GAGE family of tumor antigens found by homology walking in the dbEST database.