Property Summary

NCBI Gene PubMed Count 22
PubMed Score 12.53
PubTator Score 9.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7766 1.7e-05
psoriasis 6514 6.0e-05
diabetes mellitus 1683 1.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Cockayne syndrome 59 5.204 2.6
Xeroderma pigmentosum 42 3.85 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.200 1.8e-03
osteosarcoma -1.875 1.7e-05
psoriasis -1.500 6.0e-05

Gene RIF (8)

AA Sequence

MVVMARLSRPERPDLVFEEEDLPYEEEIMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKL      1 - 70
WYRYLKARRAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRAL     71 - 140
PITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLDEAAQRLATVVNDERFV    141 - 210
SKAGKSNYQLWHELCDLISQNPDKVQSLNVDAIIRGGLTRFTDQLGKLWCSLADYYIRSGHFEKARDVYE    211 - 280
EAIRTVMTVRDFTQVFDSYAQFEESMIAAKMETASELGREEEDDVDLELRLARFEQLISRRPLLLNSVLL    281 - 350
RQNPHHVHEWHKRVALHQGRPREIINTYTEAVQTVDPFKATGKPHTLWVAFAKFYEDNGQLDDARVILEK    351 - 420
ATKVNFKQVDDLASVWCQCGELELRHENYDEALRLLRKATALPARRAEYFDGSEPVQNRVYKSLKVWSML    421 - 490
ADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFLEEHKYFEESFKAYERGISLFKWPNVSDIWSTY    491 - 560
LTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLYAQLEEEWGLARHAMAVYERATRAVEPAQQYD    561 - 630
MFNIYIKRAAEIYGVTHTRGIYQKAIEVLSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTT    631 - 700
GAFWQTWKDFEVRHGNEDTIKEMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMK    701 - 770
LLEQRAEQLAAEAERDQPLRAQSKILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLE    771 - 840
QQSVPAAVFGSLKED                                                           841 - 855
//

Text Mined References (27)

PMID Year Title