Property Summary

NCBI Gene PubMed Count 121
PubMed Score 114.41
PubTator Score 49.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Muscular atrophy 67
Disease Target Count Z-score Confidence
Cancer 2346 3.665 1.8
Disease Target Count Z-score Confidence
Histiocytoid hemangioma 3 4.298 2.1
Fibrochondrogenesis 8 3.022 1.5
Disease Target Count
Epithelioid hemangioendothelioma 5

Expression

  Differential Expression (35)

Disease log2 FC p
gastric cancer 1.300 1.6e-04
psoriasis 1.900 2.7e-09
astrocytoma 1.600 3.8e-11
glioblastoma multiforme 2.400 3.9e-27
osteosarcoma 2.347 1.8e-04
posterior fossa group A ependymoma 2.500 1.2e-13
atypical teratoid / rhabdoid tumor 2.300 2.5e-06
medulloblastoma, large-cell -1.100 5.0e-02
Duchenne muscular dystrophy 2.114 3.4e-09
autosomal dominant Emery-Dreifuss muscul... 1.488 8.7e-03
Becker muscular dystrophy 1.167 2.8e-02
juvenile dermatomyositis 1.772 1.2e-10
Amyotrophic Lateral Sclerosis 1.125 1.0e-04
acute quadriplegic myopathy 1.360 4.1e-04
limb girdle muscular dystrophy 2A 1.015 7.3e-04
intraductal papillary-mucinous adenoma (... -1.800 2.3e-03
intraductal papillary-mucinous carcinoma... -2.600 4.7e-03
intraductal papillary-mucinous neoplasm ... -1.300 3.3e-02
colon cancer -1.900 1.5e-02
active Crohn's disease 2.326 3.9e-02
diabetes mellitus -1.100 2.3e-02
pediatric high grade glioma 1.500 1.6e-03
group 4 medulloblastoma -1.400 8.5e-03
pilocytic astrocytoma 2.200 1.6e-08
subependymal giant cell astrocytoma 3.146 3.6e-03
lung carcinoma -1.700 1.3e-19
spina bifida -1.921 3.7e-02
Pick disease 1.700 6.7e-03
Breast cancer -1.500 1.1e-06
invasive ductal carcinoma -1.700 5.7e-03
ulcerative colitis 1.500 4.8e-04
ovarian cancer 2.100 5.5e-05
pituitary cancer -2.100 3.0e-05
Down syndrome 1.300 6.2e-03
dermatomyositis 1.300 5.5e-03

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (107)

PMID Text
26838548 ABL kinases promote breast cancer osteolytic metastasis by modulating tumor-bone interactions through TAZ and STAT5 signaling.
26678338 MYC-driven change in mitochondrial dynamics limits YAP/TAZ function in mammary epithelial cells and breast neoplasms.
26668268 Actin remodeling confers BRAF inhibitor resistance to melanoma cells through YAP/TAZ activation
26667495 A YAP/TAZ-miR-130/301 molecular circuit exerts systems-level control of fibrosis in a network of human diseases and physiologic conditions
26611634 The TAZ play an essential role in amino acid-induced mTORC1 activation, particularly under nutrient-limiting conditions.
26567630 TAZ may be involved in pancreatic tissue regeneration, and that deregulation of these proteins may play a role in neoplastic transformation and stellate cell functions in both PDAC and pancreatitis.
26491017 activation of the Nherf1-PP1alpha-TAZ pathway in osteoblasts is targeted by histone deacetylase inhibitors
26464030 Suggest that high expression of TAZ plays a significant role in retinoblastoma's aggressiveness, and predicts poor prognosis for patients with retinoblastoma.
26439301 YAP/TAZ regulate transcriptional elongation from the enhancer elements by recruiting the Mediator complex and promoting phenotypes of overgrowth and tumorigenesis.
26432639 This study identifies a novel mechanism of TAZ regulation by YAP, which has significant implications for our understanding of Hippo pathway regulation, YAP-isoform specific signaling, and the role of these proteins in cell proliferation, apoptosis, and tumorigenesis
26420216 these studies demonstrate that TAZ and YAP exhibit different functional roles in hepatocellular carcinoma progression, including chemoresistance and tumorigenicity
26416426 Results show TAZ functioned as an oncogene and promoted pancreatic cancer epithelial-mesenchymal transition and progression.
26381823 these data reveal a previously unknown role for TAZ and the Hippo pathway in the progression of aggressive subtypes of endometrial cancer.
26320173 factor:TAZ transcriptional co-activator and activation of sE-Cadherin/proto-oncogene protein HER-2 signaling could be potential oncogenic pathways for breast cancer (BC) metastasis.
26315112 preS2 upregulates TAZ expression by repressing miRNA-338-3p. TAZ is necessary for preS2-promoted HCC proliferation and migration.
26136233 Compelling preclinical evidence showed that TAZ/YAP are often aberrantly engaged in breast cancer, where their hyperactivation culminates into a variety of tumor-promoting functions. (Review)
26125451 MicroRNA-9-3p was identified as the tumour-suppressor miR targetting TAZ expression in hepatocellular carcinoma cells.
26116754 PARD3 promotes interaction between PP1A and LATS1 to induce LATS1 dephosphorylation and inactivation,leading to dephosphorylation and activation of TAZ
26104008 FAT1 protein acts upstream of Hippo signalling through TAZ protein to regulate neuronal differentiation.
26059435 Taken together, these results complement our previous findings and establish bidirectional crosstalk between HIF-1alpha and TAZ that increases their transcriptional activities in hypoxic cells.
26043698 TAZ inhibits temozolomide induced apoptosis via upregulation of MCL-1 (myeloid cell leukemia 1) and high expression of TAZ predicts a poor prognosis for GBM patients
25995450 TAZ negatively regulate transcription of DeltaNp63 through TEAD1,2,3 and 4 transcription factors.
25979969 Data suggest that activation of TAZ (tafazzin) inhibits adipogenesis in mesenchymal stem cells; interaction of TAZ and protein phosphatases (PP1A, PP2A) up-regulates dephosphorylation and transport of TAZ to cell nucleus.
25961935 Our findings elucidate the mechanistic basis of the oncogenic properties of TAZ-CAMTA1 fusion
25940705 Overexpression of TAZ in neuroblastoma BE(2)-C cells increases cell proliferation, self renewal and colony formation. TAZ knockdown reverses this. TAZ promotes cell proliferation and tumorigenicity by up-regulating CTGF and PDGF-beta genes.
25895125 In ovarian cancer cells, miR-129-5p, directly represses TAZ expression, leading to the inactivation of TEA domain transcription, and the downregulation of Hippo downstream genes, connective tissue growth factor and Cyclin A.
25870251 Patients with strong TAZ expression showed poorer clinical outcomes with respect to both recurrence and overall survival.
25849865 Cytoplasmic retention of YAP/TAZ correlates with active ciliogenesis. knockdown of YAP/TAZ is sufficient to induce ciliogenesis, whereas YAP/TAZ hyperactivation suppresses serum starvation-mediated ciliogenesis.
25843714 Our demonstration of the transcriptional co-repressor activity of YAP/TAZ opens a new avenue for understanding the Hippo signaling pathway.
25817592 we demonstrate additional structural complexity in WWTR1-CAMTA1 fusion transcripts in epithelioid haemangioendothelioma
25794680 The study defines a YAP/TAZ-regulated transcriptional program in oral squamous cell carcinoma and reveals novel roles for nuclear YAP/TAZ activity in the onset and progression of this cancer.
25760078 HDAC9 promotes tumor formation of glioblastoma via TAZ-mediated EGFR pathway activation.
25704916 findings have revealed critical links between TAZ, EMT and CSCs in OSCC initiation and progression, and also established TAZ as a novel cancer biomarker and viable druggable target for OSCC therapeutics.
25652178 Data shows that YAP and Taz play important roles in organ size control and normal tissue regeneration and there expression is upregulated in many human cancer. [review]
25650113 Results revealed that TAZ is a differentially expressed molecule in human hepatocellular carcinoma (HCC) suggesting it as an important regulator, TAZ might be as a new diagnostic biomarker in HCC.
25633292 miR-141 is a potent tumor suppressor in the stomach, and its growth inhibitory effects are, in part, mediated through its downstream target gene, TAZ.
25592648 this article summarizes the current understanding of the biological functions of YAP and TAZ, and how the regulation of these two proteins can be disrupted in cancer.[Review][
25587023 Human breast cancer database analysis revealed that increased expression (greater than the median) of both TAZ and HIF-1 target genes, but neither one alone, is associated with significantly increased patient mortality.
25561492 TAZ regulates the transcription of the alpha5 subunit of LM511 and the formation of a LM511 matrix
25542152 miR-125a-5p is an important regulator of TAZ in glioma cells
25502501 Immortalized fibroblasts conditionally expressing active YAP or TAZ mutant proteins overcome soft matrix limitations on growth and promote fibrosis
25495189 TAZ is associated with the proliferation and invasiveness of HCC cells.
25425573 Conversely, increased expression of betaPIX in breast cancer cell lines re-couples the Hippo kinase cassette to Yap/Taz, promoting localization of Yap/Taz to the cytoplasm and inhibiting cell migration and proliferation.
25361000 we demonstrate that the oncogenic activity of TAZ is essential for propagation of the malignant phenotype in triple-negative breast cancer
25354978 Overexpression of TAZ upregulates connective tissue growth factor (CTGF)expression and Taz induces CTGF expression via modulating the activation of TGF-beta/Smad3 signaling pathway.
25353289 Report CAMTA1-WWTR1 gene fusion in thoracic epithelioid hemangioendothelioma but not epithelioid angiosarcoma.
25290150 YAP, TAZ and HSP90 take part in contact guidance and intercellular junction formation in corneal epithelial cells.
25078107 TAZ and YAP are differentially regulated by hypoxia in cancer cells
25029906 Over expression of TAZ was associated with abnormal expression of beta-catenin, which is correlated with poor prognosis of patients with adenocarcinoma of the esophagogastric junction
24951773 Our findings emphasize the tumorigenic role of TAZ and may serve as the basis for new treatment strategies.
24860833 There was no significant correlation between the expression of TAZ and AREG in hepatocellular carcinoma tissues.
24747426 knowledge of how YAP and TAZ function as mechanosensors and mechanotransducers
24707483 TAZ is highly expressed in SRCC.
24648515 Nuclear TAZ/YAP also cooperate with TGFbeta signaling to promote phenotypic and transcriptional changes in nontumorigenic cells to overcome TGFbeta-repressive effects.
24613358 TAZ interacts with components of the SWI/SNF complex to modulate lineage-specific gene expression.
24531710 this study designates TAZ as a novel biomarker and a possible therapeutic target for breast cancer
24515112 ECG stimulates osteoblast differentiation through the activation of TAZ and RUNX2, revealing a novel mechanism for green tea-stimulated osteoblast differentiation
24510127 these results show that TAZ mediates Wnt3a-stimulated osteogenic differentiation through PP1A, suggesting that the Wnt signal regulates the Hippo pathway.
24324261 post-transcriptional regulation of Dicer is controlled by the cell density-mediated localization of the Hippo pathway effectors TAZ (transcriptional co-activator with PDZ-binding motif) and YAP (Yes-associated protein) (TAZ/YAP).
23959471 WWTR1 promotes malignant cell growth and inhibits apoptosis by cyclin A and CTGF regulation.
23954413 Study reports that physical and architectural features of a multicellular sheet inform cells about their proliferative capacity through mechanical regulation of YAP and TAZ, known mediators of Hippo signaling and organ growth. YAP/TAZ activity is confined to cells exposed to mechanical stresses.
23897276 Both YAP and TAZ contribute to the invasive and metastatic capacity of melanoma cells.
23780915 convergent optimization of the YAP/TAZ TEAD binding site suggests that the similarity in the affinities of binding of YAP to TEAD and of TAZ to TEAD is important for Hippo pathway functionality.
23762387 Overexpression of TAZ is associated with metastasis in colorectal cancer.
23727052 In conclusion, substratum stiffness alters YAP/TAZ expression and YAP localization in trabecularmeshwork cells which then may modulate the expression of extracellular matrix proteins important in glaucoma.
23695671 Expression of miR-135b, LZTS1, LATS2 and nuclear TAZ predicts poor outcomes of non-small-cell lung cancer.
23673366 TAZ protein and TEAD transcription factors interaction is functionally important for TAZ-induced cell migration.
23566416 Considering bone-metastasis specimens, nuclear HIF-1alpha-TAZ co-localisation occurred in neoplastic and supportive cells, such as fibroblasts and endotheliocytes.
23372686 TAZ regulates AXL, and plays an important role in clonogenicity and non-adherent growth in vitro and tumor formation in vivo.
23258147 Stiffer substrates resulted in upregulation of canonical Wnt modulators, TAZ and sFRP-1, and thus may influence the progression of glaucoma.
23245942 TAZ activation is a general feature of Wnt signaling and is functionally relevant to mediate Wnt biological effects.
23026745 NPHP9 promotes signalling through the transcriptional co-activator TAZ.
22895435 Studies indicate that the transcriptional co-activators YAP and TAZ recently emerged as key mediators of the biological effects that are observed in response to extracellular matrix (ECM) elasticity and cell shape.
22825057 TAZ-dependent secretion of AREG indicates that activation of the EGFR signaling is an important non-cell-autonomous effector of the Hippo pathway, and TAZ as well as its targets may play significant roles in breast tumorigenesis and metastasis.
22717556 The aim of the present paper was to evaluate Wwox and TAZ, nuclear effectors of Hippo-related pathways, were involved in E-cadherin expression in bone metastases specimens from breast cancer.
22692215 a novel mechanism of TAZ regulation and role of TAZ in modulating tissue growth and tumor development in response to PI3K signaling.
22481233 High TAZ expression is associated with non-small cell lung cancer.
22470139 WWTR1 is an oncogene and has an important role in the proliferation of colorectal cancer cells and in tumor growth in vivo.
22429593 Using reverse transcription-polymerase chain reaction (RT-PCR) and subsequent sequencing, we confirmed an identical WWTR1-CAMTA1 fusion transcript product from different nodules in each patient.
22234184 The authors show that YAP and TAZ, the transcriptional co-activators in the Hippo pathway, suppress Wnt signalling without suppressing the stability of beta-catenin but through preventing its nuclear translocation.
22190458 TAZ expression was lower in proneural glioblastomas and lower-grade gliomas, which correlated with CpG island hypermethylation of the TAZ promoter compared with mesenchymal glioblastomas
22108137 Results demonstrate that kaempferol fortifies TAZ activity, which enhances RUNX2-mediated osteoblast differentiation and suppresses PPARgamma-stimulated adipocyte differentiation.
22078877 Study shows that the activity of TAZ, a transducer of the Hippo pathway, is required to sustain self-renewal and tumor-initiation capacities in breast cancer stem cells.
22045023 TAZ promotes breast cell growth partially through protecting KLF5 from WWP1-mediated degradation and enhancing KLF5's activities.
21654799 findings identify YAP/TAZ as sensors and mediators of mechanical cues instructed by the cellular microenvironment
21584898 the presence of a WWTR1-CAMTA1 fusion in all EHE tested from bone, soft tissue, and visceral location
21349946 Findings define the TAZ-TEAD-Cyr61/CTGF signaling pathway as an important modifier of the Taxol response in breast cancer cells.
21224387 novel mechanism to restrict the activity of TAZ and YAP through physical interaction with Amot and AmotL1
21189257 PP1A and ASPP2 play a critical role in promoting TAZ function by antagonizing the LATS kinase through TAZ dephosphorylation.
21131195 the activated effectors of the RAS/RAF/MEK (mitogen-activated protein kinase)/ERK (extracellular-signal-regulated kinase) signalling pathway are involved in the expression of TAZ, supporting the idea that this may also occur in thyroid papillary carcinoma
20972459 Data show that direct interaction of Wbp2 with TAZ depends on the WW domain of TAZ.
20858893 Hippo pathway negatively regulates TAZ function by both limiting its nuclear accumulation and promoting its degradation.
20850437 the first PDZ domain of zona occludens-1 (ZO-1) and 2 (ZO-2) interacts with the carboxy-terminal PDZ binding motif of TAZ
20164440 The present study was aimed at investigating the role of TAZ in uterine physiology by examining its presence in the human uterine endometrium and its involvement in in vitro decidualization of human stromal fibroblasts.
20049872 data indicate that TNF-alpha enhances osteogenic differentiation of adipocyte mesenchymal stem cells via the activation of NF-kappaB and a subsequent increase of TAZ expression
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19542741 Observational study of gene-disease association. (HuGE Navigator)
19542741 TAZ mutations are not a cause of thyroid dysgenesis in the series of patients studied.
19538860 CD138(+) myeloma cells inhibited mRNA expression of TAZ in mesenchymal stem cells, which could be partially reversed by blocking TNF-alpha.
19460752 Knockdown of WW domain containing transcription regulator 1 (WWTR1; TAZ) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19324877 Disruption of TEAD-TAZ binding or silencing of TEAD expression blocked the function of TAZ to promote cell proliferation and to induce epithelial-mesenchymal transition, demonstrating TEAD as a key downstream effector of TAZ.
19324876 These results reveal a novel mechanism for TEADs to regulate nuclear retention and thus the transforming ability of TAZ.
18568018 Data demonstrate that in response to TGFbeta stimulation the transcriptional regulator TAZ binds heteromeric Smad2/3-4 complexes and is recruited to TGFbeta response elements.
18413727 TAZ plays a role in the migration, invasion, and tumorigenesis of breast cancer cells and thus presents a novel target for the detection and treatment of breast cancer.
18374411 Seven placental transcripts characterize HELLP-syndrome.
17927494 Decreased osteogenic potential of mesenchymal stem cells of myeloma patients was in part due to TNF-alpha suppressed TAZ expression.
16099986 coactivates Runx2-dependent gene transcription while repressing PPARgamma-dependent gene transcription; results indicate that TAZ functions as a molecular rheostat that modulates mesenchymal stem cell differentiation

AA Sequence

MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSS      1 - 70
GGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQR     71 - 140
YFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHP    141 - 210
TQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVN    211 - 280
PPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNI    281 - 350
NPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL                        351 - 400
//

Text Mined References (128)

PMID Year Title
26838548 2016 ABL kinases promote breast cancer osteolytic metastasis by modulating tumor-bone interactions through TAZ and STAT5 signaling.
26678338 2015 A MYC-Driven Change in Mitochondrial Dynamics Limits YAP/TAZ Function in Mammary Epithelial Cells and Breast Cancer.
26668268 2016 Actin remodeling confers BRAF inhibitor resistance to melanoma cells through YAP/TAZ activation.
26667495 2015 A YAP/TAZ-miR-130/301 molecular circuit exerts systems-level control of fibrosis in a network of human diseases and physiologic conditions.
26611634 2015 The Hippo pathway effectors YAP and TAZ promote cell growth by modulating amino acid signaling to mTORC1.
26567630 2015 Role of YAP and TAZ in pancreatic ductal adenocarcinoma and in stellate cells associated with cancer and chronic pancreatitis.
26491017 2015 Histone Deacetylase Inhibitors Target the Leukemic Microenvironment by Enhancing a Nherf1-Protein Phosphatase 1?-TAZ Signaling Pathway in Osteoblasts.
26464030 2015 High expression of TAZ indicates a poor prognosis in retinoblastoma.
26439301 2015 YAP Drives Growth by Controlling Transcriptional Pause Release from Dynamic Enhancers.
26432639 2015 TAZ Protein Accumulation Is Negatively Regulated by YAP Abundance in Mammalian Cells.
26420216 2015 An Imbalance in TAZ and YAP Expression in Hepatocellular Carcinoma Confers Cancer Stem Cell-like Behaviors Contributing to Disease Progression.
26416426 2015 Hippo transducer TAZ promotes epithelial mesenchymal transition and supports pancreatic cancer progression.
26381823 2015 A role for the transducer of the Hippo pathway, TAZ, in the development of aggressive types of endometrial cancer.
26320173 2015 RUNX2 and TAZ-dependent signaling pathways regulate soluble E-Cadherin levels and tumorsphere formation in breast cancer cells.
26315112 2015 HBV preS2 promotes the expression of TAZ via miRNA-338-3p to enhance the tumorigenesis of hepatocellular carcinoma.
26243870 2015 Yap and Taz are required for Ret-dependent urinary tract morphogenesis.
26136233 2015 The Hippo transducers TAZ and YAP in breast cancer: oncogenic activities and clinical implications.
26125451 2015 miR-9-3p plays a tumour-suppressor role by targeting TAZ (WWTR1) in hepatocellular carcinoma cells.
26116754 2015 PARD3 induces TAZ activation and cell growth by promoting LATS1 and PP1 interaction.
26104008 2015 FAT1 cadherin acts upstream of Hippo signalling through TAZ to regulate neuronal differentiation.
26059435 2015 HIF-1? and TAZ serve as reciprocal co-activators in human breast cancer cells.
26043698 2015 TAZ promotes temozolomide resistance by upregulating MCL-1 in human glioma cells.
25995450 2015 Hippo Component TAZ Functions as a Co-repressor and Negatively Regulates ?Np63 Transcription through TEA Domain (TEAD) Transcription Factor.
25979969 2015 A cell-based screening for TAZ activators identifies ethacridine, a widely used antiseptic and abortifacient, as a compound that promotes dephosphorylation of TAZ and inhibits adipogenesis in C3H10T1/2 cells.
25961935 2016 Mechanism of action of a WWTR1(TAZ)-CAMTA1 fusion oncoprotein.
25940705 2015 Transcriptional co-activator TAZ sustains proliferation and tumorigenicity of neuroblastoma by targeting CTGF and PDGF-?.
25895125 2015 A novel role for microRNA-129-5p in inhibiting ovarian cancer cell proliferation and survival via direct suppression of transcriptional co-activators YAP and TAZ.
25870251 2015 Nuclear TAZ expression associates with the triple-negative phenotype in breast cancer.
25849865 2015 Actin remodelling factors control ciliogenesis by regulating YAP/TAZ activity and vesicle trafficking.
25843714 2015 Transcriptional co-repressor function of the hippo pathway transducers YAP and TAZ.
25817592 2015 Molecular characterization of epithelioid haemangioendotheliomas identifies novel WWTR1-CAMTA1 fusion variants.
25794680 2015 A YAP/TAZ-Regulated Molecular Signature Is Associated with Oral Squamous Cell Carcinoma.
25760078 2015 HDAC9 promotes glioblastoma growth via TAZ-mediated EGFR pathway activation.
25704916 2015 The Hippo transducer TAZ promotes epithelial to mesenchymal transition and cancer stem cell maintenance in oral cancer.
25652178 2015 YAP/TAZ for cancer therapy: opportunities and challenges (review).
25650113 2015 Functional and clinical evidence that TAZ is a candidate oncogene in hepatocellular carcinoma.
25633292 2015 MicroRNA-141 inhibits tumor growth and metastasis in gastric cancer by directly targeting transcriptional co-activator with PDZ-binding motif, TAZ.
25592648 2015 The emerging roles of YAP and TAZ in cancer.
25587023 2014 Hypoxia-inducible factor 1 mediates TAZ expression and nuclear localization to induce the breast cancer stem cell phenotype.
25561492 2015 A laminin 511 matrix is regulated by TAZ and functions as the ligand for the ?6B?1 integrin to sustain breast cancer stem cells.
25542152 2015 MiRNA-125a-5p inhibits glioblastoma cell proliferation and promotes cell differentiation by targeting TAZ.
25502501 2015 Mechanosignaling through YAP and TAZ drives fibroblast activation and fibrosis.
25495189 2015 TAZ regulates cell proliferation and epithelial-mesenchymal transition of human hepatocellular carcinoma.
25425573 2014 Arhgef7 promotes activation of the Hippo pathway core kinase Lats.
25361000 2014 Molecular profiling and computational network analysis of TAZ-mediated mammary tumorigenesis identifies actionable therapeutic targets.
25354978 2015 TAZ promotes epithelial to mesenchymal transition via the upregulation of connective tissue growth factor expression in neuroblastoma cells.
25353289 2015 Thoracic epithelioid malignant vascular tumors: a clinicopathologic study of 52 cases with emphasis on pathologic grading and molecular studies of WWTR1-CAMTA1 fusions.
25290150 2014 Involvement of YAP, TAZ and HSP90 in contact guidance and intercellular junction formation in corneal epithelial cells.
25078107 2014 Hypoxic conditions differentially regulate TAZ and YAP in cancer cells.
25029906 2014 Prognostic impact of TAZ and ?-catenin expression in adenocarcinoma of the esophagogastric junction.
24951773 2014 An integrative analysis of the tumorigenic role of TAZ in human non-small cell lung cancer.
24860833 2014 Expression and clinical significance of YAP, TAZ, and AREG in hepatocellular carcinoma.
24747426 2014 YAP/TAZ as mechanosensors and mechanotransducers in regulating organ size and tumor growth.
24707483 2014 TAZ is highly expressed in gastric signet ring cell carcinoma.
24648515 2014 The transcriptional regulators TAZ and YAP direct transforming growth factor ?-induced tumorigenic phenotypes in breast cancer cells.
24613358 2014 The Hippo transducer TAZ interacts with the SWI/SNF complex to regulate breast epithelial lineage commitment.
24531710 2015 TAZ is required for metastatic activity and chemoresistance of breast cancer stem cells.
24515112 2014 (-)-Epicatechin gallate (ECG) stimulates osteoblast differentiation via Runt-related transcription factor 2 (RUNX2) and transcriptional coactivator with PDZ-binding motif (TAZ)-mediated transcriptional activation.
24510127 2014 Canonical Wnt signalling activates TAZ through PP1A during osteogenic differentiation.
24324261 2014 The Hippo pathway effectors TAZ/YAP regulate dicer expression and microRNA biogenesis through Let-7.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23959471 2014 TR1 promotes cell proliferation and inhibits apoptosis through cyclin A and CTGF regulation in non-small cell lung cancer.
23954413 2013 A mechanical checkpoint controls multicellular growth through YAP/TAZ regulation by actin-processing factors.
23897276 2014 Pro-invasive activity of the Hippo pathway effectors YAP and TAZ in cutaneous melanoma.
23780915 2013 The TEAD4-YAP/TAZ protein-protein interaction: expected similarities and unexpected differences.
23762387 2013 Overexpression of YAP and TAZ is an independent predictor of prognosis in colorectal cancer and related to the proliferation and metastasis of colon cancer cells.
23727052 2013 Substratum stiffness and latrunculin B modulate the gene expression of the mechanotransducers YAP and TAZ in human trabecular meshwork cells.
23695671 2013 MicroRNA-135b promotes lung cancer metastasis by regulating multiple targets in the Hippo pathway and LZTS1.
23673366 2013 BMP4 is a novel transcriptional target and mediator of mammary cell migration downstream of the Hippo pathway component TAZ.
23566416 2013 Hypoxia inducible factor-1 is activated by transcriptional co-activator with PDZ-binding motif (TAZ) versus WWdomain-containing oxidoreductase (WWOX) in hypoxic microenvironment of bone metastasis from breast cancer.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
23372686 2013 TAZ expression as a prognostic indicator in colorectal cancer.
23258147 2013 Role of substratum stiffness in modulating genes associated with extracellular matrix and mechanotransducers YAP and TAZ.
23245942 2012 Role of TAZ as mediator of Wnt signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23026745 2012 The ciliopathy disease protein NPHP9 promotes nuclear delivery and activation of the oncogenic transcriptional regulator TAZ.
22895435 2012 Transduction of mechanical and cytoskeletal cues by YAP and TAZ.
22825057 2012 TAZ induces growth factor-independent proliferation through activation of EGFR ligand amphiregulin.
22717556 2013 Bone metastatic process of breast cancer involves methylation state affecting E-cadherin expression through TAZ and WWOX nuclear effectors.
22692215 2012 The N-terminal phosphodegron targets TAZ/WWTR1 protein for SCF?-TrCP-dependent degradation in response to phosphatidylinositol 3-kinase inhibition.
22481233 2012 Prognostic significance of TAZ expression in resected non-small cell lung cancer.
22470139 2012 Lentivirus-mediated RNA interference targeting WWTR1 in human colorectal cancer cells inhibits cell proliferation in vitro and tumor growth in vivo.
22429593 Monoclonality of multifocal epithelioid hemangioendothelioma of the liver by analysis of WWTR1-CAMTA1 breakpoints.
22234184 2012 A molecular mechanism that links Hippo signalling to the inhibition of Wnt/?-catenin signalling.
22190458 2011 The transcriptional coactivator TAZ regulates mesenchymal differentiation in malignant glioma.
22108137 2012 TAZ is required for the osteogenic and anti-adipogenic activities of kaempferol.
22078877 2011 The Hippo transducer TAZ confers cancer stem cell-related traits on breast cancer cells.
22045023 2012 TAZ antagonizes the WWP1-mediated KLF5 degradation and promotes breast cell proliferation and tumorigenesis.
21654799 2011 Role of YAP/TAZ in mechanotransduction.
21584898 2011 A novel WWTR1-CAMTA1 gene fusion is a consistent abnormality in epithelioid hemangioendothelioma of different anatomic sites.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21349946 2011 Taxol resistance in breast cancer cells is mediated by the hippo pathway component TAZ and its downstream transcriptional targets Cyr61 and CTGF.
21224387 2011 Hippo pathway-independent restriction of TAZ and YAP by angiomotin.
21189257 2011 PP1 cooperates with ASPP2 to dephosphorylate and activate TAZ.
21131195 2011 TAZ/WWTR1 is overexpressed in papillary thyroid carcinoma.
20972459 2011 WW domain-mediated interaction with Wbp2 is important for the oncogenic property of TAZ.
20936779 2010 A human MAP kinase interactome.
20858893 2010 The hippo tumor pathway promotes TAZ degradation by phosphorylating a phosphodegron and recruiting the SCF{beta}-TrCP E3 ligase.
20850437 2010 TAZ interacts with zonula occludens-1 and -2 proteins in a PDZ-1 dependent manner.
20594350 2010 A novel mechanism of cell growth regulation by Cell Cycle and Apoptosis Regulatory Protein (CARP)-1.
20412773 2010 The Hippo pathway regulates Wnt/beta-catenin signaling.
20164440 2010 Human transcriptional coactivator with PDZ-binding motif (TAZ) is downregulated during decidualization.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20049872 2010 NF-kappaB activation stimulates osteogenic differentiation of mesenchymal stem cells derived from human adipose tissue by increasing TAZ expression.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19542741 2009 Mutations in TAZ/WWTR1, a co-activator of NKX2.1 and PAX8 are not a frequent cause of thyroid dysgenesis.
19538860 2009 [The effect of TNF-alpha on TAZ expression and osteogenic potential of mesenchymal stem cells from myeloma patients].
19324877 2009 TEAD transcription factors mediate the function of TAZ in cell growth and epithelial-mesenchymal transition.
19324876 2009 TEADs mediate nuclear retention of TAZ to promote oncogenic transformation.
19010321 2009 TAZ is a coactivator for Pax8 and TTF-1, two transcription factors involved in thyroid differentiation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18568018 2008 TAZ controls Smad nucleocytoplasmic shuttling and regulates human embryonic stem-cell self-renewal.
18413727 2008 A role for TAZ in migration, invasion, and tumorigenesis of breast cancer cells.
18374411 2008 Seven placental transcripts characterize HELLP-syndrome.
18227151 2008 TAZ promotes cell proliferation and epithelial-mesenchymal transition and is inhibited by the hippo pathway.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17927494 2007 Elevated tumor necrosis factor-alpha suppresses TAZ expression and impairs osteogenic potential of Flk-1+ mesenchymal stem cells in patients with multiple myeloma.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16099986 2005 TAZ, a transcriptional modulator of mesenchymal stem cell differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15096513 2004 Heterogeneous nuclear ribonuclear protein U associates with YAP and regulates its co-activation of Bax transcription.
14970209 2004 TAZ interacts with TTF-1 and regulates expression of surfactant protein-C.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11118213 2000 TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins.