Property Summary

NCBI Gene PubMed Count 44
PubMed Score 38.97
PubTator Score 27.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
oligodendroglioma 1.200 2.1e-02
psoriasis 1.700 1.7e-04
lung cancer -1.100 2.0e-03
pilocytic astrocytoma 1.200 9.0e-04
COPD -1.200 5.7e-03
ovarian cancer -1.700 4.7e-11

 GWAS Trait (1)

Protein-protein Interaction (7)

Gene RIF (15)

PMID Text
25356737 majority of ovarian carcinomas harbored homozygous or heterozygous deletions in WWP2 locus, and there was an inverse correlation in the expression levels between WWP2 and Notch3 in ovarian carcinomas
25266661 Data provide evidence that the stability of Paip1 can be regulated by ubiquitin-mediated degradation, thus highlighting the importance of WWP2 as a suppressor of translation.
25071155 Results identify WWP2 as a novel p73-associated protein that ubiquitinates and degrades p73.
24365151 Wwp2 acts as a ubiquitin ligase of SRG3.
23938591 WWP2-N is downregulated in stage IIIC melanoma and up-regulated in stage II/III prostate cancer, and WWP2-FL and WWP2-C overexpression is associated with early-stage breast cancer.
23651516 Koala retrovirus Gag PPPY L-domain interacts with the WW domain(s) of WWP2 and progeny virions are released from cells by utilizing the multivesicular body sorting pathway.
21532586 WWP2 controls cellular apoptosis and is required for tumorigenicity of cells
21258410 Data show that the WWP2-N isoform interacts with Smad2 and Smad3, whereas WWP2-C interacts only with Smad7.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19651900 AIP2 regulates activation-induced T-cell death by suppressing EGR2-mediated FasL expression via the ubiquitin pathway
19274063 The WWP2 protein is an important regulator for maintaining a proper POU5F1 protein level in human Embryonic Stem Cells.
18570872 cIAP1 and cIAP2 promote cancer cell survival by functioning as E3 ubiquitin ligases that maintain constitutive ubiquitination of the RIP1 adaptor protein.
15548568 Data show that WWP2 and Nedd4-2 both bind to the cardiac sodium channel Na(v)1.5, but only Nedd4-2 robustly ubiquitinated and downregulated Na(v)1.5.
12450395 First demonstration of ubiquitin-protein ligase WWP2 from human lung cDNA library recruited by penton base proteins of adenovirus serotypes Ad2 and Ad3 in vitro and in vivo.
12167593 expression, binding, and functional data all suggest that WWP2 is a candidate to regulate ENaC-mediated Na(+) transport in epithelia

AA Sequence

MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEI      1 - 70
IILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIF     71 - 140
LDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQ    141 - 210
SPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAE    211 - 280
GEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVD    281 - 350
HNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASTDHDPLGPLPPGWEKRQDNGRV    351 - 420
YYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGA    421 - 490
YDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRGEEGLDYGGIA    491 - 560
REWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPF    561 - 630
YKRMLNKRPTLKDLESIDPEFYNSIVWIKENNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEEN    631 - 700
KEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRHYT    701 - 770
KNSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDKVGKETWLPRSHTCFN    771 - 840
RLDLPPYKSYEQLREKLLYAIEETEGFGQE                                            841 - 870
//

Text Mined References (50)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25356737 2014 Notch3 interactome analysis identified WWP2 as a negative regulator of Notch3 signaling in ovarian cancer.
25266661 2014 Paip1, an effective stimulator of translation initiation, is targeted by WWP2 for ubiquitination and degradation.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25071155 2014 WWP2-WWP1 ubiquitin ligase complex coordinated by PPM1G maintains the balance between cellular p73 and ?Np73 levels.
24365151 2014 Wwp2 targets SRG3, a scaffold protein of the SWI/SNF-like BAF complex, for ubiquitination and degradation.
24105792 2014 Protein microarray characterization of the S-nitrosoproteome.
23938591 2013 Novel WWP2 ubiquitin ligase isoforms as potential prognostic markers and molecular targets in cancer.
23651516 2013 Identification of cellular factors required for the budding of koala retrovirus.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23236378 2012 Mammalian ? arrestins link activated seven transmembrane receptors to Nedd4 family e3 ubiquitin ligases and interact with ? arrestins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23146381 2013 A meta-analysis of genome-wide association studies for serum total IgE in diverse study populations.
21847096 2011 Pin1 and WWP2 regulate GluR2 Q/R site RNA editing by ADAR2 with opposing effects.
21750408 2011 WWP2 ubiquitin ligase and its isoforms: new biological insight and promising disease targets.
21572392 2011 SCFFBXL¹? regulates BMP signalling by directing the degradation of HECT-type ubiquitin ligase Smurf1.
21532586 2011 WWP2 is an E3 ubiquitin ligase for PTEN.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21258410 2011 Selective targeting of activating and inhibitory Smads by distinct WWP2 ubiquitin ligase isoforms differentially modulates TGF? signalling and EMT.
20858735 2010 Interactions of ErbB4 and Kap1 connect the growth factor and DNA damage response pathways.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19651900 2009 The HECT-type E3 ubiquitin ligase AIP2 inhibits activation-induced T-cell death by catalyzing EGR2 ubiquitination.
19343052 2009 Control of the activity of WW-HECT domain E3 ubiquitin ligases by NDFIP proteins.
19274063 2009 WWP2 promotes degradation of transcription factor OCT4 in human embryonic stem cells.
18776082 2008 Regulation of the divalent metal ion transporter DMT1 and iron homeostasis by a ubiquitin-dependent mechanism involving Ndfips and WWP2.
18729074 2008 Identification of novel Smad2 and Smad3 associated proteins in response to TGF-beta1.
18570872 2008 cIAP1 and cIAP2 facilitate cancer cell survival by functioning as E3 ligases that promote RIP1 ubiquitination.
17719543 2007 Autoinhibition of the HECT-type ubiquitin ligase Smurf2 through its C2 domain.
17289006 2007 The KCNQ1 potassium channel is down-regulated by ubiquitylating enzymes of the Nedd4/Nedd4-like family.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15548568 2005 Molecular determinants of voltage-gated sodium channel regulation by the Nedd4/Nedd4-like proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252135 2004 N4WBP5A (Ndfip2), a Nedd4-interacting protein, localizes to multivesicular bodies and the Golgi, and has a potential role in protein trafficking.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15047715 2004 Wwp2, an E3 ubiquitin ligase that targets transcription factor Oct-4 for ubiquitination.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12450395 2002 Adenovirus protein involved in virus internalization recruits ubiquitin-protein ligases.
12167593 2002 Ubiquitin-protein ligase WWP2 binds to and downregulates the epithelial Na(+) channel.
11748237 2002 N4WBP5, a potential target for ubiquitination by the Nedd4 family of proteins, is a novel Golgi-associated protein.
9647693 1998 Atrophin-1, the DRPLA gene product, interacts with two families of WW domain-containing proteins.
9595660 1998 Identification of a human cDNA clone that mediates adherence of pathogenic Neisseria to non-binding cells.
9169421 1997 Identification of novel human WW domain-containing proteins by cloning of ligand targets.