Property Summary

NCBI Gene PubMed Count 54
PubMed Score 42.80
PubTator Score 42.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.1e-08
osteosarcoma 7933 8.4e-07
Pick disease 1893 1.1e-05
ovarian cancer 8491 2.2e-03
group 3 medulloblastoma 2254 6.8e-03
active Crohn's disease 918 2.2e-02
Disease Target Count Z-score Confidence
Paraplegia 71 3.157 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.300 1.1e-08
osteosarcoma 2.734 8.4e-07
active Crohn's disease 1.193 2.2e-02
group 3 medulloblastoma -1.100 6.8e-03
Pick disease 1.300 1.1e-05
ovarian cancer 1.400 2.2e-03

Protein-protein Interaction (3)

Gene RIF (38)

PMID Text
26506518 Overexpression of WWP1 promotes tumorigenesis in patients with hepatocellular carcinoma.
26152726 The cancer-driven alteration of WWP1 culminates in excessive TbetaRI degradation and attenuated TGFbeta1 cytostatic signaling, a consequence that could conceivably confer tumorigenic properties to WWP1.
25814387 PTPN14, a Pez mammalian homolog, is degraded by overexpressed Su(dx) or Su(dx) homologue WWP1 in mammalian cells.
25755729 miR-21 overexpression or WWP1 knockdown in endothelial progenitor cells significantly activates the TGFbeta signaling pathway and inhibits cell proliferation.
25293520 Most notably, WWP1 downregulation both inactivated PTEN-Akt signaling pathway in MKN-45 and AGS cells. our findings suggest that WWP1 acts as an oncogenic factor and should be considered as a novel interfering molecular target for gastric carcinoma
25071155 Data show that WWP1, which specifically ubiquitinates and degrades DeltaNp73 heterodimerizes with another E3 ligase, WWP2.
25051198 Results suggest that elevated transcription and expression levels of ubiquitin ligase E3s WWP1, Smurf1 and Smurf2 genes may be the mechanisms of occurrence, development and metastasis of prostate cancer.
24792179 Knocking down WWP1 promoted cleaved caspase3 protein and p53 expression in hepatocellular carcinoma cells, and caspase3 inhibition could prevent cell apoptosis induced by the knockdown of WWP1.
23849376 results reveal that WWP1 might play an oncogenic role in oral cancer cells.
23573293 LATS1 is critical in mediating WWP1-induced increased cell proliferation in breast cancer cells.
23293026 WWP1 down-regulates AMPKalpha2 under high glucose culture conditions via the ubiquitin-proteasome pathway
22266093 WWP1 negatively regulates cell migration to CXCL12 by limiting CXCR4 degradation to promote breast cancer metastasis to bone.
22051607 WWP1 may function as the E3 ligase for several PY motif-containing proteins, such as Smad2, KLF5, p63, ErbB4/HER4, RUNX2, JunB, RNF11, SPG20, and Gag, as well as several non-PY motif containing proteins, such as TbetaR1, Smad4, KLF2, and EPS15. Review.
22045023 TAZ promotes breast cell growth partially through protecting KLF5 from WWP1-mediated degradation and enhancing KLF5's activities.
21996799 WWP1 mutations are not a common cause of human dystroglycanopathy.
21795702 WWP1 markedly inhibited the replicative senescence induced by p27(Kip1) by promoting p27(Kip1) degradation.
21480222 WWP1 depletion-induced apoptosis was rescued by the overexpression of the wild-type WWP1 but not the E3 ligase inactive WWP1-C890A mutant in MCF7 cells.
21191027 The authors show that WWP1 changes the ubiquitination status of ARRDC1, suggesting that the arrestins may provide a platform for ubiquitination in PPXY-dependent budding.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20951678 WWP1 regulates DeltaNp63 transcriptional activity, acting thus as a potential regulator of the proliferation and survival of epithelial-derived cells.
19580544 SPG20 interacts with AIP4 and AIP5.
19561640 WWP1 and its family members suppress the ErbB4 expression and function in breast cancer
19307600 Experiments suggest functions for WWP1 and SPG20 in the regulation of lipid droplet turnover and potential pathological mechanisms in Troyer syndrome.
19267401 Overexpression of WWP1 is associated with the estrogen receptor and insulin-like growth factor receptor 1 in breast carcinoma
19047365 WWP1 ubiquitinated and caused the degradation of HER4 but not of EGFR, HER2, or HER3.
19035836 analysis of the interaction between ubiquitin ligase WWP1 and Nogo-A
18806757 WWP1 may have a context-dependent role in regulating cell survival through targeting different p63 proteins for degradation.
18724389 WWP1 may promote cell proliferation and survival partially through suppressing RNF11-mediated ErbB2 and EGFR downregulation in human cancer cells.
17609263 the interaction between Gag and WWP1 is required for functions other than Gag ubiquitination
17330240 genomic aberrations of WWP1 may contribute to the pathogenesis of breast cancer
17016436 WWP1 overexpression is a common mechanism involved in the inactivation of TGFbeta function in human cancer.
16924229 these findings identify the first instance of a ubiquitin ligase that causes stabilization of p53 while inactivating its transcriptional activities.
16785210 Full-length expressed WWP1 could interact in vitro with the cytoplasmic domain of human Notch1, which also regulate the nuclear localization of WWP1.
16223724 KLF5 is a target of the E3 ubiquitin ligase WWP1 for proteolysis in epithelial cells
15221015 WWP1 negatively regulates TGF-beta signaling in cooperation with Smad7.
12535537 Data show that the crystal structure of the HECT domain of the human ubiquitin ligase WWP1/AIP5 maintains a two-lobed structure like the HECT domain of the human ubiquitin ligase E6AP.
12450395 First demonstration of ubiquitin-protein ligase WWP1 from human lung cDNA library recruited by penton base proteins of human adenovirus serotypes Ad2 and Ad3 in vitro and in vivo.
12450395 the interaction of nonenveloped viruses with ubiquitin-protein ligases of host cells.

AA Sequence

MATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEITKTAKSSSSSNPKWDEQLTV      1 - 70
NVTPQTTLEFQVWSHRTLKADALLGKATIDLKQALLIHNRKLERVKEQLKLSLENKNGIAQTGELTVVLD     71 - 140
GLVIEQENITNCSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNG    141 - 210
DNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGTPVVSEENALSPNCTSTTVED    211 - 280
PPVQEILTSSENNECIPSTSAELESEARSILEPDTSNSRSSSAFEAAKSRQPDGCMDPVRQQSGNANTET    281 - 350
LPSGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRRRVYYVDHNTRTTTWQRPTMESVRNF    351 - 420
EQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTKTTQWEDPRTQ    421 - 490
GLQNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQIAYERGFRWKLAHFRYLCQS    491 - 560
NALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCL    561 - 630
FEYAGKNNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESID    631 - 700
TEFYNSLIWIRDNNIEECGLEMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQ    701 - 770
EQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDN    771 - 840
EVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSYEQLKEKLL    841 - 910
FAIEETEGFGQE                                                              911 - 922
//

Text Mined References (56)

PMID Year Title
26506518 2015 Overexpression of WWP1 promotes tumorigenesis and predicts unfavorable prognosis in patients with hepatocellular carcinoma.
26152726 2015 Functional Characterization of a WWP1/Tiul1 Tumor-derived Mutant Reveals a Paradigm of Its Constitutive Activation in Human Cancer.
25814387 2015 Suppressor of Deltex mediates Pez degradation and modulates Drosophila midgut homeostasis.
25755729 2015 MiR-21 suppresses endothelial progenitor cell proliferation by activating the TGF? signaling pathway via downregulation of WWP1.
25416956 2014 A proteome-scale map of the human interactome network.
25293520 2015 WWP1 as a potential tumor oncogene regulates PTEN-Akt signaling pathway in human gastric carcinoma.
25071155 2014 WWP2-WWP1 ubiquitin ligase complex coordinated by PPM1G maintains the balance between cellular p73 and ?Np73 levels.
25051198 2014 Bortezomib prevents oncogenesis and bone metastasis of prostate cancer by inhibiting WWP1, Smurf1 and Smurf2.
24792179 2014 Knockdown of WWP1 inhibits growth and induces apoptosis in hepatoma carcinoma cells through the activation of caspase3 and p53.
23849376 2013 WWP1 gene is a potential molecular target of human oral cancer.
23573293 2013 WWP1 E3 ligase targets LATS1 for ubiquitin-mediated degradation in breast cancer cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23293026 2013 E3 ubiquitin ligase, WWP1, interacts with AMPK?2 and down-regulates its expression in skeletal muscle C2C12 cells.
22266093 2012 The ubiquitin E3 ligase WWP1 decreases CXCL12-mediated MDA231 breast cancer cell migration and bone metastasis.
22051607 2012 WWP1: a versatile ubiquitin E3 ligase in signaling and diseases.
22045023 2012 TAZ antagonizes the WWP1-mediated KLF5 degradation and promotes breast cell proliferation and tumorigenesis.
21996799 2011 Exclusion of WWP1 mutations in a cohort of dystroglycanopathy patients.
21795702 2011 WW domain-containing E3 ubiquitin protein ligase 1 (WWP1) delays cellular senescence by promoting p27(Kip1) degradation in human diploid fibroblasts.
21480222 2012 The WWP1 ubiquitin E3 ligase increases TRAIL resistance in breast cancer.
21191027 2011 Multiple interactions between the ESCRT machinery and arrestin-related proteins: implications for PPXY-dependent budding.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20951678 2010 The E3 ubiquitin ligase WWP1 regulates ?Np63-dependent transcription through Lys63 linkages.
19580544 2009 Endogenous spartin (SPG20) is recruited to endosomes and lipid droplets and interacts with the ubiquitin E3 ligases AIP4 and AIP5.
19561640 2009 WW domain containing E3 ubiquitin protein ligase 1 targets the full-length ErbB4 for ubiquitin-mediated degradation in breast cancer.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19343052 2009 Control of the activity of WW-HECT domain E3 ubiquitin ligases by NDFIP proteins.
19307600 2009 A role for ubiquitin ligases and Spartin/SPG20 in lipid droplet turnover.
19267401 2009 Overexpression of WWP1 is associated with the estrogen receptor and insulin-like growth factor receptor 1 in breast carcinoma.
19047365 2009 The E3 ubiquitin ligase WWP1 selectively targets HER4 and its proteolytically derived signaling isoforms for degradation.
19035836 2008 Identification and structural mechanism for a novel interaction between a ubiquitin ligase WWP1 and Nogo-A, a key inhibitor for central nervous system regeneration.
18806757 2008 WW domain-containing E3 ubiquitin protein ligase 1 targets p63 transcription factor for ubiquitin-mediated proteasomal degradation and regulates apoptosis.
18724389 2008 The WW domain containing E3 ubiquitin protein ligase 1 upregulates ErbB2 and EGFR through RING finger protein 11.
17609263 2007 The role of WWP1-Gag interaction and Gag ubiquitination in assembly and release of human T-cell leukemia virus type 1.
17330240 2007 The amplified WWP1 gene is a potential molecular target in breast cancer.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17016436 2007 Ubiquitin E3 ligase WWP1 as an oncogenic factor in human prostate cancer.
16924229 2007 Regulation of p53 localization and transcription by the HECT domain E3 ligase WWP1.
16785210 Regulation of the nuclear localization of the human Nedd4-related WWP1 protein by Notch.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16223724 2005 Human Kruppel-like factor 5 is a target of the E3 ubiquitin ligase WWP1 for proteolysis in epithelial cells.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15359284 2004 The novel E3 ubiquitin ligase Tiul1 associates with TGIF to target Smad2 for degradation.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15221015 2004 Negative regulation of transforming growth factor-beta (TGF-beta) signaling by WW domain-containing protein 1 (WWP1).
12535537 2003 Conformational flexibility underlies ubiquitin ligation mediated by the WWP1 HECT domain E3 ligase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12450395 2002 Adenovirus protein involved in virus internalization recruits ubiquitin-protein ligases.
11779188 2002 Alternative splicing determines the domain structure of WWP1, a Nedd4 family protein.
11375995 2001 Lung Krüppel-like factor contains an autoinhibitory domain that regulates its transcriptional activation by binding WWP1, an E3 ubiquitin ligase.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
9753456 1998 Physical and functional interactions between the transactivation domain of the hematopoietic transcription factor NF-E2 and WW domains.
9647693 1998 Atrophin-1, the DRPLA gene product, interacts with two families of WW domain-containing proteins.
9169421 1997 Identification of novel human WW domain-containing proteins by cloning of ligand targets.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.