Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.22
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 2.000 1.3e-03
malignant mesothelioma 1.300 5.4e-07
psoriasis -1.700 1.3e-04
osteosarcoma -1.671 3.7e-04
astrocytoma 1.100 8.7e-03
primary pancreatic ductal adenocarcinoma 1.608 3.7e-03
lung cancer -3.100 1.9e-06
active Crohn's disease 1.169 1.0e-02
active ulcerative colitis 1.042 8.8e-03
lung adenocarcinoma -1.300 6.0e-11
lung carcinoma -1.400 1.4e-22
ovarian cancer 2.000 4.3e-06
pancreatic cancer 1.600 2.5e-03

Synonym

Accession Q9ULE0 A8KA96 Q659C1 Q9BTQ1
Symbols BM042

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

AA Sequence

MDHINKLTQIEDPREQWRREQERMLKEYLIVAQEALNAKKEIYQIKQQRFELAQEEYQQLHKMCEDDSRS      1 - 70
YASSFSGYSTNTKYDPHQIKAEIASRRDRLSRLKRELTQMKQELQYKEKGVETLQEIDRKMSSTHTSYKL     71 - 140
DEAQAIMSELRTIKKAICTGEKERRDLMHSLAKLTDSFKNSCSVTDSLVDFPHHVGVPGDAGVPQQFCDA    141 - 210
GSQTDIIGEFVFDDKTRLVDRVRLNWQYEEARKRVANIQQQLARLDNESWPSTAEADRDRLQLIKEKEAL    211 - 280
LQELQLIIAQRRSAGDVARLEEERERLEEELRRARATSAQGATERILLQEKRNCLLMQLEEATRLTSYLQ    281 - 350
SQLKSLCASTLTVSSGSSRGSLASSRGSLASSRGSLSSVSFTDIYGLPQYEKPDAEGSQLLRFDLIPFDS    351 - 420
LGRDAPFSEPPGPSGFHKQRRSLDTPQSLASLSSRSSLSSLSPPSSPLDTPFLPASRDSPLAQLADSCEG    421 - 490
PGLGALDRLRAHASAMGDEDLPGMAALQPHGVPGDGEGPHERGPPPASAPVGGTVTLREDSAKRLERRAR    491 - 560
RISACLSDYSLASDSGVFEPLTKRNEDAEEPAYGDTASNGDPQIHVGLLRDSGSECLLVHVLQLKNPAGL    561 - 630
AVKEDCKVHIRVYLPPLDSGTPNTYCSKALEFQVPLVFNEVFRIPVHSSALTLKSLQLYVCSVTPQLQEE    631 - 700
LLGIAQINLADYDSLSEMQLRWHSVQVFTSSEPSRTREAGCAGESSARDPAHTISISGKTDAVTVLLART    701 - 770
TAQLQAVERELAEERAKLEYTEEEVLEMERKEEQAEAISERSWQADSVDSGCSNCTQTSPPYPEPCCMGI    771 - 840
DSILGHPFAAQAGPYSPEKFQPSPLKVDKETNTEDLFLEEAASLVKERPSRRARGSPFVRSGTIVRSQTF    841 - 910
SPGARSQYVCRLYRSDSDSSTLPRKSPFVRNTLERRTLRYKQSCRSSLAELMARTSLDLELDLQASRTRQ    911 - 980
RQLNEELCALRELRQRLEDAQLRGQTDLPPWVLRDERLRGLLREAERQTRQTKLDYRHEQAAEKMLKKAS    981 - 1050
KEIYQLRGQSHKEPIQVQTFREKIAFFTRPRINIPPLPADDV                               1051 - 1092
//

Text Mined References (11)

PMID Year Title
24682284 2014 Evolutionary and molecular facts link the WWC protein family to Hippo signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.