Property Summary

NCBI Gene PubMed Count 31
PubMed Score 14.27
PubTator Score 20.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.124 2.5e-02
osteosarcoma -1.505 6.5e-06
acute quadriplegic myopathy 1.125 7.3e-06
juvenile dermatomyositis 1.017 6.1e-12
primary pancreatic ductal adenocarcinoma 1.072 4.0e-02
tuberculosis -1.400 2.0e-07
group 3 medulloblastoma 1.200 1.3e-02
ovarian cancer -2.200 3.1e-06

Gene RIF (11)

PMID Text
24413322 WTAP has an important role in abnormal proliferation and arrested differentiation of leukemia cells, and WTAP is a novel client protein of Hsp90
24407421 WTAP as a regulatory subunit is required for formation of a functional m6A methyltransferase complex including METTL3 and METTL14, which play an important role in the regulation of gene expression and alternative splicing.
24100041 the WTAP complex is a novel component of the RNA processing machinery, implying an important role in both posttranscriptional control and cell cycle regulation.
23354623 WTAP regulates migration and invasion of cholangiocarcinoma cells.
22957919 WTAP overexpression made cancer cells more tumorigenic
19969384 WTAP level in poodocytes is a valuable alternative technique in the study of podocyte injury in diabetic nephropathy.
19605357 Nuclear degradation of Wilms tumor 1-associating protein and survivin splice variant switching underlie IGF-1-mediated survival
17095724 WTAP is a novel regulator of the cell cycle and cell survival and implicate a WTAP-WT1 axis as a novel pathway for controlling vascular smooth muscle cell phenotype.
17088532 WTAP as an essential factor for the stabilization of cyclin A2 mRNA, thereby regulating G2/M cell-cycle transition
16912181 WTAP and ATF3 Transcription Factor are activated in Wilms' tumor and accelerate tumorigenesis.
14675924 WTAP protein involved in the morphogenesis of the genitourinaty tract and in the etiology of isolated hypospadias.

AA Sequence

MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESA      1 - 70
RRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQN     71 - 140
ELSAWKFTPDSQTGKKLMAKCRMLIQENQELGRQLSQGRIAQLEAELALQKKYSEELKSSQDELNDFIIQ    141 - 210
LDEEVEGMQSTILVLQQQLKETRQQLAQYQQQQSQASAPSTSRTTASEPVEQSEATSKDCSRLTNGPSNG    211 - 280
SSSRQRTSGSGFHREGNTTEDDFPSSPGNGNKSSNSSEERTGRGGSGYVNQLSAGYESVDSPTGSENSLT    281 - 350
HQSNDTDSSHDPQEEKAVSGKGNRTVGSRHVQNGLDSSVNVQGSVL                            351 - 396
//

Text Mined References (42)

PMID Year Title
26458103 2015 Dynamic m(6)A mRNA methylation directs translational control of heat shock response.
25416956 2014 A proteome-scale map of the human interactome network.
24981863 2014 Perturbation of m6A writers reveals two distinct classes of mRNA methylation at internal and 5' sites.
24413322 2014 WTAP is a novel oncogenic protein in acute myeloid leukemia.
24407421 2014 Mammalian WTAP is a regulatory subunit of the RNA N6-methyladenosine methyltransferase.
24316715 2014 A METTL3-METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylation.
24100041 2013 Identification of Wilms' tumor 1-associating protein complex and its role in alternative splicing and the cell cycle.
23354623 2013 WTAP regulates migration and invasion of cholangiocarcinoma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22957919 2012 Expression and roles of Wilms' tumor 1-associating protein in glioblastoma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19969384 2010 Evaluation of podocyte lesion in patients with diabetic nephropathy: Wilms' tumor-1 protein used as a podocyte marker.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19605357 2009 Nuclear degradation of Wilms tumor 1-associating protein and survivin splice variant switching underlie IGF-1-mediated survival.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19084217 2009 Variants in TF and HFE explain approximately 40% of genetic variation in serum-transferrin levels.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18505803 2008 MTA is an Arabidopsis messenger RNA adenosine methylase and interacts with a homolog of a sex-specific splicing factor.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17095724 2006 Wilms' tumor 1-associating protein regulates the proliferation of vascular smooth muscle cells.
17088532 2006 Wilms' tumor 1-associating protein regulates G2/M transition through stabilization of cyclin A2 mRNA.
16912181 2006 Wilms' tumor 1 and signal transducers and activators of transcription 3 synergistically promote cell proliferation: a possible mechanism in sporadic Wilms' tumor.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14675924 2003 Exclusion of WTAP and HOXA13 as candidate genes for isolated hypospadias.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12522145 2003 Identification of targets for calcium signaling through the copine family of proteins. Characterization of a coiled-coil copine-binding motif.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444081 2003 Biochemical function of female-lethal (2)D/Wilms' tumor suppressor-1-associated proteins in alternative pre-mRNA splicing.
11001926 2000 Identification of WTAP, a novel Wilms' tumour 1-associating protein.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.