Property Summary

NCBI Gene PubMed Count 582
PubMed Score 3138.88
PubTator Score 1864.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Intellectual disability 1016
Cryptorchidism 296
Abdomen distended 43
Abdominal Pain 98
Abnormality of the peritoneum 2
Acute Promyelocytic Leukemia 40
Ambiguous genitalia due to virilization 9
Ambiguous genitalia, female 9
Ambiguous genitalia, male 9
Aplasia/Hypoplasia of the iris 10
Autosomal recessive predisposition 1442
Blepharoptosis 231
Cataract 297
Childhood onset 38
Chronic kidney disease stage 5 31
Cloudy cornea 33
Congenital diaphragmatic hernia 67
Contiguous gene syndrome 2
Corneal stromal opacities 33
Deletion 11p13 3
Diaphragmatic Hernia 40
Diffuse mesangial sclerosis (disorder) 7
Displacement of the external urethral meatus 3
Dull foveal reflex 9
Dull intelligence 645
Everted lower lip vermilion 54
Focal glomerulosclerosis 37
Foveal hypoplasia (finding) 9
Glaucoma 239
Gonadal Dysgenesis 28
Gonadal Dysgenesis, Mixed 19
Gonadal tissue inappropriate for external genitalia or chromosomal sex 1
Hearing abnormality 12
Hepatomegaly 285
Hypertensive disease 292
Hypoplasia of the optic nerve 17
Hypoplastic mandible condyle 275
Ileus 19
Increase in blood pressure 119
Kidney Diseases 114
Kidney Failure 111
Kidney damage 25
Lens Opacities 231
Leukemia, Myelocytic, Acute 120
Low Vision 174
Low intelligence 645
MEACHAM SYNDROME (disorder) 1
Male Pseudohermaphroditism 19
Mammary Neoplasms 425
Mandibular hypoplasia 275
Mediastinal lymphadenopathy 10
Mental Retardation 645
Mental deficiency 645
Micrognathism 275
Myeloid Leukemia, Chronic 23
Nausea and vomiting 97
Nephrotic Syndrome 78
Nystagmus 317
Ovarian Failure, Premature 9
Ovarian gonadoblastoma 1
Pancreatic Neoplasm 85
Penile hypospadias 106
Poor school performance 645
Primary physiologic amenorrhea 55
Progressive disorder 142
Protruding lower lip 54
Pure gonadal dysgenesis 19
Renal Insufficiency 90
Renal failure in adulthood 76
Sarcoma 62
Short stature 531
Small head 374
Somatic mutation 61
Streak ovary 15
True Hermaphroditism (disorder) 4
Vaginal malformation 7
Visual Impairment 174
Disease Target Count P-value
ovarian cancer 8520 1.3e-04
lung cancer 4740 3.0e-04
intraductal papillary-mucinous neoplasm (IPMN) 3291 4.8e-02
Disease Target Count Z-score Confidence
tuberculosis 2010 0.0 3.0
Disease Target Count Z-score Confidence
Familial nephrotic syndrome 6 0.0 5.0
Prostate cancer 175 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2499 6.262 3.1

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.400 3.2e-05
intraductal papillary-mucinous neoplasm ... 2.000 4.8e-02
lung cancer -2.700 3.0e-04
ovarian cancer -1.900 1.3e-04

PDB (23)

Gene RIF (527)

AA Sequence

MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAPPPPPPPPPHS      1 - 70
FIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLES     71 - 140
QPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCT    141 - 210
GSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPI    211 - 280
LCGAQYRIHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGE    281 - 350
KPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPS    351 - 420
CQKKFARSDELVRHHNMHQRNMTKLQLAL                                             421 - 449
//

Text Mined References (592)

PMID Year Title