Property Summary

NCBI Gene PubMed Count 534
PubMed Score 3000.51
PubTator Score 1864.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
ovarian cancer 8491 1.3e-04
lung cancer 4473 3.0e-04
intraductal papillary-mucinous neoplasm (IPMN) 3289 4.8e-02
Disease Target Count Z-score Confidence
tuberculosis 1563 0.0 2.0
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 6.243 3.1

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.400 3.2e-05
intraductal papillary-mucinous neoplasm ... 2.000 4.8e-02
lung cancer -2.700 3.0e-04
ovarian cancer -1.900 1.3e-04

Gene RIF (479)

PMID Text
26997404 Letter: WT1 mutations were not present in steroid-resistant idiopathic nephrotic syndrome.
26721227 We present WT1 as a robust prognostic marker in high-grade serous ovarian carcinoma, which adds prognostic information to ER-alpha and should be kept in mind when WT1 is used as a biomarker in the context of WT1-targeting therapies.
26686990 The developmental expression regulation of WT1 protein in the human fetal heart has been presented.
26686553 Novel inguinal hernia susceptibility genes are identified as EFEMP1, WT1, EBF2 and ADAMTS6.
26655220 WT1 isoforms induce an array of miRNAs, which target the 3' UTR of EZH2 and other Polycomb-associated transcripts.
26644203 WT1 rs16754 polymorphism in AML could influence the standard chemotherapy effectiveness, specifically the variant allele (G) could be associated with increased overall survival. [meta-analysis]
26597595 A 4-gene expression score associated with high levels of Wilms Tumor-1 (WT1) expression is an adverse prognostic factor in acute myeloid leukaemia.
26573232 WT1 variant is associated with response to chemotherapy in breast cancer.
26531831 High WT1 gene expression is associated with Acute Myeloid Leukemia.
26514528 High WT1 expression levels are associated with Acute Leukemia.
26512748 HuR binds to the pyrimidine-rich sequence and antagonize its effect in regulating WT1 +/-KTS isoforms.
26499507 WT1 normal gene variant rs2234593 is associated with mutational status of WT1 Ex7 and is a prognostic marker in normal karyotype acute myeloid leukemia.
26482175 WT1 gene expression is associated with a poor outcome for patients showing non-MYCN-amplified neuroblastoma tumors.
26429162 analysis of WT1 and M-BCR-ABL expressions in chronic myeloid leukemia reveals that high WT1 expression in CML patients is detected especially in the advanced stages of the disease
26408240 WT1 gene mutation is found in diffuse mesangial sclerosis.
26406403 High WT1 expression is associated with colorectal cancer.
26371248 the results of this study demonstrate a novel association between fibrocyte-driven WT1(+) cell accumulation and severe fibrotic lung disease.
26358501 The novel mutant p. P126S and p. R370H in the WT1 gene potentially impaired GCs differentiation and oocyte-GCs interaction, which might result in loss of follicles prematurely. Therefore, WT1 is a plausible causal gene for POF.
26320177 Data show that Wilms' tumor 1 protein (WT1)binds to the zinc finger protein 224 (ZNF224) promoter and represses ZNF224 expression.
26238466 The results of this study showed that Epigenetic Changes in the Methylation Patterns WT1 and related to CRP levels after a weight loss intervention program in Obese Stroke Patients.
26224397 Wilms tumor gene single nucleotide polymorphism rs16754 is associated with response to therapy in acute lymphoblastic leukemia.
26221900 WT1 gene is a useful marker for monitoring minimal residual disease in acute leukemia.
26200099 Describe microcystic stromal tumor as a distinctive ovarian sex cord-stromal neoplasm characterized by FOXL2, SF-1, WT-1, Cyclin D1, and beta-catenin nuclear expression and CTNNB1 mutations.
26150159 Immunostaining for WT1 was characterized by a predominant cytoplasmic reactivity in the vast majority of cell types
26138637 Analysis of WT1 expression in Circulating RNA in acute myeloid leukemia patients could be a simple, convenient and noninvasive method to predict latent information about relapse.
26037530 WT1 SNPs play no role in regulating the relationship between IFN-beta and serum 25-hydroxyvitamin D in MS patients.
26012361 Evaluating WT1 and BAALC gene expression at diagnosis may improve standard risk stratification and possibly refine the therapeutic approach for Myelodysplastic syndromes patients.
25929687 WT1 (and p63) act as oncogenes in squamous cell carcinoma of the head and neck, affecting multiple genes involved in cancer cell growth.
25881478 This review focuses on the immunohistochemical profile of WT1 protein in the most common malignant tumors of children and adolescents
25858532 This review focuses on the dynamic immunohistochemical expression and distribution of WT1 protein during human ontogenesis, providing illustrations and discussion on the most relevant findings
25841655 The WT1(GG) patients showed significantly higher WT1 mRNA expression than the WT1(GA/AA) patients (P=0.01). In summary, WT1 rs16754 may serve as an independent biomarker in AML patients from South Chinese.
25800978 The comparative evaluation of the immunohistochemical findings revealed that WT1 cytoplasmic expression in rhabdomyosarcoma may represent an ontogenetic reversal, and this nuclear transcription factor can also be considered an oncofetal protein
25794157 Hypoxia-sensitive epigenetic regulation of an antisense-oriented lncRNA controls WT1 expression in myeloid leukemia cells
25773860 Possible significance of WT-1 endothelial expression as a marker of neo-angiogenesis in meningiomas.
25758068 WT1 might be a good marker to differentiate low blast percentage MDS and cytopenia VR
25748047 In summary, our study suggests that WT1 may be a potential marker to predict DFS/RFS/PFS in solid tumor patients. Further studies are needed to confirm the role of WT1 expression in clinical practice.
25714774 results suggest that the overexpression of WT1 may play an important role in the leukemic transformation of MPNs.
25688735 We detected WT1 abnormalities in 25 (81%) of 31 patients.
25613309 Results suggest that WT1 and c-MYC expression is important for survival in KRAS mutant tumors as opposed to KRAS wild-type non-small cell lung tumors.
25601757 TET2 suppresses leukemia cell proliferation and colony formation in a manner dependent on WT1.
25572170 This meta-analysis concluded that WT1 had poor prognostic impact on overall survival and disease-free survival in patients with acute myeloid leukemia.
25510679 Wt1 is a major regulator of tumor angiogenesis and progression.
25498507 results support the idea that MRD monitoring by MFC should be suggested before and 30 days after the transplant, while WT1 expression should be preferred after this procedure.
25482556 WT1 physically interacts with TET2 and TET3, and WT1 loss of function results in a similar hematopoietic differentiation phenotype as observed with TET2 deficiency.
25474318 These results indicate that WT1 knockdown attenuates the biological behavior of MPNST cells by decreasing Akt activity, demonstrating that WT1 is involved in the development and progression of malignant peripheral nerve sheath tumors
25460359 One month post-HSCT WT1 expression was a useful marker for minimal residual disease and relapse prediction in association with chronic GVHD in the context of HSCT for MDS.
25454478 Case Report: EWSR1-WT1 fusion in a small round blue cell tumor of the cauda equina with smooth muscle differentiation and an indolent course.
25451826 results suggest a role for rare WT1 damaging variants in severe spermatogenic failure in populations of European ancestry
25447528 Wilms' tumor 1 enhances Cisplatin-resistance of advanced NSCLC
25426668 WT1 expression is of prognostic value in patients with APL, and determination of expression levels might contribute to risk stratifi cation in the future.
25418835 WT1[17AA(-)KTS(+)] isoform had a function to promote HR-mediated DNA repair.
25398938 Our results highlight a strong association between mutant WT1 and DNA hypermethylation in Acute myeloid leukemia
25391383 The Gene-based analyses revealed four significant associations in the WT1, ZC3H12C, DLGAP2, and GPR1 genes at p < 0.05. in this study.
25387409 Expression of WT1and IRF8 showed a moderate inverse correlation in acute myeloid leukemia patients. WT1 can be used as an minimal residual disease marker, especially in patients without recurrent genetic abnormalities.
25331950 WT1 suppresses epigenetic silencing of the beta-catenin gene
25312909 These findings indicate that WT1 variants may play a role in altering the effects of IFN-beta on vitamin D in multiple sclerosis
25310451 these data suggest that WT1 functions as an oncogene in leukemia cells, and one important mechanism is regulation of the Wnt/beta-catenin pathway
25243629 WT1 transcript levels serve as a diagnostic relapse test with greater sensitivity than the morphologic approach used in the clinic as a readout.
25238704 High level of WT1 is associated with relapse in hematological diseases.
25232865 WT1 has a role in interacting MAD2 and regulating mitotic checkpoint function
25202702 These data suggest the usefulness of WT1 monitoring from peripheral blood to predict the relapse in allotransplanted acute myeloid leukemia patients.
25145932 R458Q mutation alters the regulation of podocyte homeostasis and causes nonsyndromic focal segmental glomerulosclerosis
25110071 WT1 mutations are secondary events in AML, show varying frequencies and impact on prognosis between genetic subgroups.
25062258 WT1 does not seem to be a suitable indicator of growth phase for cutaneous melanomas
25033726 WT-1 has prognostic value, being predictive of disease-free survival.
25026998 High WT1 protein expression is associated with soft tissue sarcoma.
25026287 Positive WT1 MRD (defined as > 0.5% in the peripheral blood) after induction and at the end of treatment were both significantly associated with a higher risk of relapse and a shorter overall survival.
25005570 The different cellular localization of WT1, namely nuclear, cytoplasmic or nucleo-cytoplasmic, in different benign and malignant tumors supports the hypothesis that this transcription factor plays a complex role in tumorigenesis.
24966966 Cytoplasmic WT-1 is found in a broad spectrum of benign and neoplastic vascular lesions.
24954546 WT1 transcript levels in leukapheresis of peripheral blood hematopoietic cells predict relapse risk in patients autografted for acute myeloid leukemia.
24934812 EWS-WT1 can activate neural gene expression and direct partial neural differentiation via ASCL1, suggesting agents that promote neural differentiation might offer a novel therapeutic approach to treat DSRCT.
24927120 In this review, WT1 is a master regulator of organ development, a tumor suppressor and an oncogene.
24894814 Exogenous expression of WT1 gene remarkably affected biological behaviors of U937 cells.
24893204 This study shows that Zn(II) binding to the Cys2His2 site in WT1-4 provides at least -17.6 kcal/mol in driving force to fold the protein scaffold.
24856380 A phenotypic female had C>T transition at position +4 of the WT1 intron 9 (c.1432+4C>T) splice-donor site, and another phenotypic female was heterozygous for G>A transition at position +5 (c.1432+5G>A).
24810959 High expression of WT1 causes increased angiogenesis in Ewing Sarcoma.
24784346 This review gives an insight into the importance of WT1 in pelvic gynecological malignancies and the first taken steps into the world of WT1 immunotherapy.
24778040 we found that high levels of WT1 expression correlated with aggressive clinical features in ovarian cancer
24713986 Intralobar and perilobar rests and the tumors arising from these rests differ morphologically and are characterized by 2 different sets of genetic abnormalities involving 2 adjacent foci, WT1 and WT2.
24667279 WT1 overexpression is associated with acute myeloid leukemia.
24633336 p53, human telomerase reverse transcriptase, Wilms tumor-1, and vascular endothelial growth factor receptor 2, could induce specific cytotoxic T lymphocytes that showed cytotoxicity against pancreatic cancer cell lines.
24619359 In Wilms tumor cells, mutant WT1 proteins facilitate expression of cell cycle genes by antagonizing transcriptional repression mediated by p53.
24607494 High WT1 expression in gliomas is associated with astrocytic tumour differentiation, indicating a worse outcome in univariable survival analysis for diffuse astrocytic tumours with WT1 expression.
24596380 High WT1 expression is associated with breast cancer.
24534946 Our results demonstrated an aberrant methylation pattern at a CTCF binding site downstream the WT1 gene, which is associated with an elevated WT1 transcriptional activity
24503937 WT1 behaves as an anti-apoptotic molecule in MDA-MB-468 cells
24503796 Identified a mechanism by which IGF-I up-regulates WT1, at the posttranscriptional level in MCF-7 cells and primary breast tumor samples. WT1 may play an important role in breast cancer tumorigenesis.
24413855 There was no underlying WT1 mutation identified in any patient with steroid-resistant nephrotic syndome
24405639 Data indicate a methylation signature of the alternative (A)WT1 promoter CpG island that is a promising marker for classifying myeloid-derived leukemias.
24402088 WT1 mutations constitute a rare but important genetic cause of steroid-resistant nephrotic syndrome, with a wide spectrum of renal and extrarenal phenotypes.
24393438 Data show that WT1-specific cytotoxic T lymphocytes (CTLs) exerted cytotoxicity against podocytes in vitro; however, they did not damage podocytes in vivo.
24374862 WT1 overexpression is associated with non-hodgkin lymphomas and acute lymphoblastic leukemia.
24373193 Loss of WT1 expression is associated with invasive ductal carcinoma of the breast.
24338413 Detection of a WT1 gene mutation in female patients with sporadic isolated steroid-resistant nephrotic syndrome.
24323466 We concluded that WT1, but not calretinin, is a useful prognostic factor in malignant pleural mesothelioma
24321497 Both isoforms of the EWS/WT1 fusion protein can function as an oncogene in desmoplastic small round cell tumors.
24265486 demonstrate that Wt1 is necessary for the morphologic integrity of pleural membrane and that loss of Wt1 contributes to IPF via MMT of PMCs into a myofibroblast phenotype
24257751 Data indicate that overexpression of Wilms tumor 1 gene (WT1) decreased CDC73 levels and promoted proliferation of oral squamous cell carcinoma (OSCC) cells.
24211094 The overexpression of WT1 in acute myeloid leukemia might be due to a relative increase in A, B and C isoforms, together with a relative decrease in isoform D expression.
24190574 these results suggest that WT1 potentiates nutlin-3-induced apoptosis by downregulating the expression of BCL-XL while upregulating that of BAK, which leads to the activation of an intrinsic apoptotic pathway.
24166496 Results show that WT1's transcriptional repression activity is modulated by the complex prohibitin-BASP1.
24161391 this study reports two non-related patients with similarities in their clinical history but with distinct WT1 mutations.
24074521 WT1 mutations are a negative prognostic indicator in intensively treated patients with AML-NK, may be a part of molecularly based risk assessment and risk-adapted treatment stratification of patients with AML-NK.
23979985 the presence of WT1 mutation was related to a poor prognosis in patients with CN-AML, excluding those with FLT3-ITD and those younger than 3 years.
23956224 high WT1 expression predicted decreased survival in children with acute myeloid leukemia in univariate, but not multivariate, analysis
23945386 WT1 overexpression is associated with the development and progression of non-small-cell lung cancer.
23936312 WT1 is an oncogene and promotes NSCLC cell proliferation by up-regulating Cyclin D1 and p-pRb expression
23898100 WT1 mRNA levels at treatment completion may predict for prognosis of acute myeloid leukemia.
23888944 this study demonstrated that an increased HOXA10 expression in human ovarian cancer is a result of the co-activation of HOXA10 gene promoter's hypomethylation and the binding of transcription factor WT1.
23874238 this elementat (TCF21) is shown to mediate signaling through platelet-derived growth factor receptor beta (PDGFR-b) and Wilms tumor 1 (WT1) .
23871158 WT1(delZ) promotes cell proliferation and expansion of progenitor cells, consistent with a possible role in leukemogenesis.
23832418 Loss of WT1 is associated with T cell leukemia.
23826993 Combinatorial expression of WT1, survivin, and TERT determine the survival outcome in adult acute myeloid leukemia.
23791475 The progressive loss of WT1 expressionin both ganglion and chromaffin cells, suggests its potential repressor role of differentiation in a precise temporal window during the development of the human peripheral sympathetic and gastroenteric nervous system.
23715653 This case is unusual in that the 1180C>T mutation, which has been found in approximately 50 % of patients with complete DDS, has been inherited and is causing mild or no symptoms of DDS.
23706170 Coordinate immunoexpression patterns of estrogen receptor, progesterone receptor, and Wilms tumor 1 have a high specificity but low sensitivity in distinguishing between endometrial serous carcinomaand ovarian serous carcinoma
23699597 These data identify a critical role for Wt1 in hematopoiesis and Vegf-a as a cellular RNA whose splicing is potentially regulated by Wt1.
23672350 higher post-HSCT BAALC and WT1 expressions in patients with CBF-AML may be good markers of minimal residual disease for the prediction of survival and relapse after HSCT.
23584566 High Bone marrow WT1 expression is associated with acute myeloid leukemia.
23554000 A novel WT1 mutation in familial wilms tumor.
23550990 Data indicate that WT1 protein single nucleotide polymorphism (SNP) rs16754 and WT1 expression have a significant impact on clinical outcome in patients with acute myeloid leukemia (AML).
23550799 Mullerian and eccrine cutaneous ciliated cysts: two different entities? The contribution of WT-1 and PAX8 to diagnosis.
23544132 The predominant presence of WT1 protein in urinary exosomes of diabetic patients and increase in its expression level with decline in renal function suggest that it could be useful as early non-invasive marker for diabetic nephropathy.
23517654 subjects with WAGR syndrome, BDNF+/- subjects had a mean Vineland Adaptive Behaviour Compose score that was lower and a mean intelligence quotient that was lower than BDNF+/+ subjects
23484026 Common WT1 mutations are not involved in clear cell renal cell carcinoma.
23480492 These results are the first example of strong T cell reactivity against WT1 in patients with NHL which also demonstrate strong cytotoxicity against peptide-loaded tumor cells.
23460320 High WT1 expression is associated with malignant skull base meningioma.
23403166 the reduction in the WT1 mRNA level is caused by its cleavage by tRNase Z(L).
23394625 Data suggest that the early assessment of WT1 transcript level at the end of induction in patients in complete remission (CR) may have a prognostic significance on clinical outcome and may thus be a useful marker for risk stratification.
23392705 Further, subcellular co-localization assay showed that the two proteins could co-localize in the cytoplasm of K562 cells, but WT1/CML28 complexes were not detected by using immunoprecipitation.
23362234 ZNF224 acts in fine tuning of WT1-dependent control of gene expression, acting as a co-activator of WT1 in the regulation of proapoptotic genes and suppressing WT1 mediated transactivation of antiapoptotitc genes.
23338265 endothelial cells lining thin-walled dilated lymphatic vessels of lymphangiomas were negative WT1 protein. Findings strengthen idea oral lymphangioma is vascular malformation due to lymphatic dilatation without significant endothelial proliferation.
23298185 WT1 expression in high grade prostate cancer may contribute to migration and metastasis.
23207289 We think that examination for WT1 and p53 in curettage specimens might help to predict the final pathological diagnosis in patients with endometrial cancer.
23142971 WT1 modulates cFLIP, FADD and NF-kappaB, and has an anti-apoptotic role in hepatocellular carconoma. This mechanism of action of WT1 could be related to the tumor growth and oncogenic potential of HCC.
23111196 Reduction in WT1 gene expression during early treatment predicts the outcome in patients with acute myeloid leukemia.
23110703 PRAME and WT1 transcripts constitute a good molecular marker combination for monitoring minimal residual disease in MDS.
23110324 WT1 mRNA expression can be a useful marker for the diagnosis and risk evaluation of MDS.
23070125 genetic association studies in a population in Spain: Data suggest that an SNP in WT1 (rs16754) is not associated with favorable outcome in patients with de novo acute myeloid leukemia.
23042785 show that depletion of WT1 in Wilms' tumour cells can lead to reactivation of gene expression from methylated promoters, such as TGFB2, a key modulator of epithelial-mesenchymal transitions
22939983 Repression of transcription by WT1-BASP1 requires the myristoylation of BASP1 and the PIP2-dependent recruitment of histone deacetylase.
22925896 Methylation of WT1 gene is significantly increased in non small cell lung cancer. Both histotype and exposure to cigarette smoke heavily influence the pattern of CpG islands which undergo hypermethylation.
22915059 higher WT1 expression at diagnosis does not correlate with poor prognosis, but that WT1 expression after induction chemotherapy is considered to be a useful predictor of clinical outcome in pediatric AML.
22898820 WT1-dependent Bcl-xL overexpression contributes to TRAIL resistance in myeloid leukemias.
22895555 genetic association study in populations in Spain and Italy: There are no associations between survival in acute promyelocytic leukemia patients and WT1 status (i.e., an SNP [rs16754; heterozygote/homozygote], mutations, or expression level of WT1).
22876585 Denys-Drash syndrome results from mutations in the WT1 gene.
22875062 Data suggest that detectable WT1 expression levels (using real-time polymerase chain reaction) in peripheral blood at diagnosis shows a strong association with adverse prognosis in myelodysplastic syndrome patients.
22800892 WTX and WT1 mutations occur independently, suggesting a relationship between their gene products.
22797561 an oncogenic role of WT1 and a possible relation between WT1 and progression of breast cancer
22796116 Constitutional WT1 or 11p15 aberrations are frequent in Wilms tumour patients.
22688351 WT1 is expressed in endothelial cells in Hodgkin lymphoma and is a possible proangiogenic factor in this disease.
22673530 expression of Wilms' tumor protein (WT1) in developing human epithelial and mesenchymal tissues
22672247 WT1 protein detected on actively proliferating cancer nests; on elongated epithelial ridge where new droplet-cancer-nests were being formed and starting infiltration toward subepithelial layer. suggests WT1 plays role in pathogenesis of some types of OSCC
22623625 T cells generated against newly identified WT1 epitopes exhibit cytotoxic activity against WT1+ leukemias.
22585769 Besides dominant-negative missense mutations in the eighth or ninth exon of WT1 and mutations at the donor splice site of intron 9, complete deletion of one WT1 allele may induce the development of focal segmental glomerulosclerosis.
22558480 Case Report: HIF- 1alpha, WT-1 and VEGF are possible protagonists in the development of bilateral primary angiosarcoma of breast.
22555024 Comparison of WT1 variant expression in AML and CML patients' groups differing in response to therapy suggested possible importance of particular WT1 variant levels as markers of further disease course.
22510877 Human Langerhans cells use an IL-15R-alpha/IL-15/pSTAT5-dependent mechanism to break T-cell tolerance against the self-differentiation tumor antigen WT1.
22506617 detected WT1 mutations in approximately 20% of the patients
22434317 Studied esmoplastic small round cell tumor-clinicopathological spectrum, including immunohistochemical analysis of 45 tumors diagnosed at a tertiary cancer referral centre, with molecular results t(11; 22)(p13; q12)(EWS-WT1) in select cases.
22415091 Nuclear translocation of Wilms' tumour protein involves importins alpha and beta, and a nuclear localisation signal in the third zinc finger
22391154 Low expression of HtrA2 and high expression of WT1 are closely related with occurrence and development of acute leukemia.
22382985 All precursor lesions associated with Wilms' tumours were positive for WT1.
22313360 we conclude that the possible upregulation of CD97 mediated by WT1 promotes cellular invasiveness-one of the most characteristic and challenging aspects of glial tumor cells.
22276610 Low WT1 expression and high mitotic count may be indicative of an unfavourable prognosis in patients with advanced malignant peritoneal mesothelioma.
22261458 PAX8 and WT1 had comparable overall detection rates in confirming ovarian origin of malignant effusion.
22246978 Six of seven fetuses with combined bilateral renal agenesis and cardiac anomalies showed abnormalities of WT1 expression in liver mesothelial cells, which was not seen in other fetuses with bilateral renal agenesis.
22242671 Immunotherapy targeting the Wilms tumor 1 (WT1) gene product is a promising treatment modality for patients with malignant gliomas, and there have been reports of encouraging results.
22238403 WT1 expression is down-regulated in the ovulatory polycystic ovary syndrome endometrium during the window of implantation.
22172722 WT1 bound to the SRPK1 promoter, and repressed expression through a specific WT1 binding site
22152856 The expression of WT1 protein was examined in 60 cases of primary pediatric tumors. WT1 protein & its mRNA were widely detected in pediatric malignancies. No significant correlation was observed between WT1 mRNA expression & clinical factors.
22148937 In NSCLC overall survival (OS) and disease-free survival (DFS) of the high WT1 expression group were longer than of the low expression group.
22093791 Simvastatin plus all-trans retinoic acid reduces expression of WT1 and DMP1 in the promyelocytic leukemia cell line NB4.
22040952 DNA methylation and deacetylation of histones are synergistic to inhibit the expression of WT1 in leukemic U937 cells.
22030397 VEGF is a direct, bona fide WT1 target gene in sarcoma; WT1 plays a key role in optimizing the response of tumor cells to hypoxia
22015946 In Korean patients with cytogenetically normal acute myeloid leukemia, WT1 SNP rs16754 had no significant impact on clinical outcomes
21985433 Abnormality of WT1 signalling may be an underlying factor in a human fetus with evolving bronchial atresia, pulmonary malformation and renal agenesis.
21980157 Transcription of nephrin-Neph3 gene pair is synergistically activated by WT1 and NF-kappaB and silenced by DNA methylation.
21967832 higher levels of WT1 in peripheral blood of acute myeloid leukemia patients at diagnosis are associated with poorer leukemia free survival
21942328 frequency and prognostic significance of FLT3 and NPM gene mutations and WT1 and BAALC gene expression in 100 consecutive patients with intermediate and poor cytogenetic risk de novo acute myeloid leukemia
21909685 Wilms tumor-1 expression is associated with distinguish schwannoma from fibroblastic meningioma.
21898091 Data show that TCR Vbeta chain usage in WT1-specific T-cell populations after single peptide vaccination.
21896989 WT1 expression is a marker of poor prognosis in colorectal cancers, independent of AJCC staging.
21888469 The relevant role played by WT1 during nephrogenesis.
21867623 WT1 plays a role in cancer promotion in childhood acute myeloid leukemia.
21851196 two de novo mutations in WT1 found in two children with Denys-Drash syndrome
21804407 WT1 is a leukemia-associated molecular marker that may be used for the diagnosis and for monitoring clinical progress in acute lymphoblastic leukemia.
21798259 WT1 exons 7-10 mutations and their correlation with other molecular markers and patients with acute myeloid leukemia characteristics
21760594 Wilms' tumor 1 single-nucleotide polymorphism rs16754 is not associated with acute myeloid leukemia.
21734473 Wilms tumor gene 1 expression was found to be an independent predictor of poor prognosis in high-grade uterine sarcoma and carcinosarcoma.
21710692 Promoter hypermethylation of PAX6, BRCA2, PAX5, WT1, CDH13 and MSH6 seems to be a frequent early event in breast cancer
21697701 GLUT1 expression is positive only in infantile hemangiomas, whereas WT1 positivity is found in all vascular neoplasms and in arteriovenous malformations.
21673345 Results suggest that gene-immunotherapy for leukemia using this WT1-siTCR system holds considerable promise.
21659357 We did not observe the previously reported adverse impact of WT1(AA) but found favorable outcomes associated with the homozygous WT1(GG).
21658388 Data indicate that pure curcumin attenuates WT1 auto-regulatory function through inhibition of PKCalpha signaling in K562 cells.
21643023 the WT1 expression level is an independent prognostic factor that can predict clinical outcomes for AL patients after HSCT and provide a guide for suitable interventions.
21607557 GEM enhanced WT1 expression in human PC cells and sensitized PC cells with WT1-specific T-cell-mediated antitumor immune response.
21508141 We detected WT1 mutations in six of 80 patients with severe hypospadias (7.5%) and at least one cryptorchid testis and in one of 10 patients with vanishing testes syndrome (10%).
21504297 WT1 was more predominant in FLT3 positive cases and less in NPM1 mutation cases, while no KIT mutation was found in FLT3/NPM1 positive cases
21499692 investigation of WT1 gene mutations is clinically useful to support definitive diagnosis in children presenting with SRNS in order to direct the most appropriate clinical management.
21447831 Only the WT1-specific T cells, but not the virus-specific T cells, displayed rapid antigen-specific effector function without prior vaccination.
21390327 PINCH1 can shuttle into the nucleus from cytoplasm in podocytes, wherein it interacts with WT1 and suppresses podocyte-specific gene expression.
21344764 Analysis of Minimal Residual Disease in acute myeloid leukemia patient level in subsequent time points showed systematic decrease of number of fusion gene transcript copies and gene WT1 expression.
21269566 The high Wt1 expression correlated with the presence of FLT3-ITD (P = 0.014) and lower rate of complete remission (P = 0.023).
21269271 Results suggest that WT1 and BASP1 play concerted, central roles in directing cell fate during differentiation. Here, WT1/BASP1 work to divert K562 cells away from blood cell lineage toward neuron phenotype.
21256590 Prevalence and clinical characteristics of N-terminally truncated WT1 expression in acute myeloid leukemia.
21209057 has been proven that hypocaloric diets induce changes in the DNA methylation pattern in PBMCs (CpG18 of ATP10A and CpG 21 of WT1) and that some of these markers could be used as early indicators of response to metabolic effects of weight-loss programs
21189390 WT1 SNP rs16754 is a potentially important molecular marker of prognosis in pediatric acute myeloid leukemia.
21189373 WT1 mutation and 11p15 loss of heterozygosity are associated with relapse in patients with very low-risk Wilms tumors who do not receive chemotherapy.
21135860 Monitoring of WT1 expression and CD34(+) donor chimerism predict relapse of acute myeloid leukemia and myelodysplastic syndrome after hematopoietic cell transplantation (HCT) with reduced-intensity conditioning (RIC).
21097671 WT1 is one of the antigens that triggers T cell-mediated myelosuppression in myelodysplastic syndrome.
21057459 WT1 and the myoepithelial cell have an important role in the histogenesis of pleomorphic adenomas.
20974136 a novel immune regulatory function of Wt1 in controlling IL-10 gene expression
20972333 Results reveal an unexpected role for WT1 as a key regulator of the genetic network of oncogenic KRAS and provide important insight into the mechanisms that regulate proliferation or senescence in response to oncogenic signals.
20971509 Data indicate that bortezomib used alone in MDS shows modest hematologic efficacy but appears to affect the WT1 gene expression.
20959405 Observational study of gene-disease association. (HuGE Navigator)
20885852 This review will discuss recent advances in our understanding of kidney progenitor cells, and the recent identification of WT1 target genes in these cells.
20880116 Observational study of gene-disease association. (HuGE Navigator)
20871039 Tumor-produced WT1, which may regulate the expression of VEGF, is found to be associated with induction of angiogenesis in endometrial cancer
20861915 results suggest high frequency of cell proliferation gene mutations may contribute to leukemogenesis in NUP98-related leukemia; simultaneous occurrence of FLT3-ITD and WT1 aberrations may have an important role in outcome of NUP98-related leukemia
20849384 Data show that WT1 mRNA levels in the peripheral blood can predict relapse after CR.
20842112 Multiple pathways for hTERT regulation by WT1 in clear cell renal cell carcinoma.
20736771 malignant Mullerian mixed tumor is another genital tract malignancy which can over express WT1
20678218 Mutations in WT13 are associated with acute myeloid leukemias.
20678218 Observational study of gene-disease association. (HuGE Navigator)
20651072 Heat shock protein 90 (Hsp90), which plays a critical role in the folding and maturation of several oncogenic proteins, associates with WT1 protein and stabilizes its expression.
20644087 No prognostic impact of the WT1 gene single nucleotide polymorphism rs16754 in pediatric acute myeloid leukemia.
20644087 Observational study of gene-disease association. (HuGE Navigator)
20619457 The structures of HLA-A*0201 bound to the native 126-134 epitope of the WT1 peptide & its R1Y variant were determined. R1Y alters the positions of MHC charged side chains near the N-terminus & reduces peptide/MHC electrostatic surface potential.
20619105 The decreesed expression of WT1 gene inhibits cell proliferation and promotes apoptosis.
20595692 Report genotype/phenotype correlation regarding the outcome and risk for Wilms tumor in 52 patients from 51 families with nephrotic syndrome due to WT1 mutations.
20592250 Observational study of gene-disease association. (HuGE Navigator)
20591825 ZNF224 acts as a transcriptional co-regulator of WT1.
20561402 Alteration of wt1 gene expression affects the cell proliferation and cell cycle Ph(+) K562 cells.
20507940 Observational study of gene-disease association. (HuGE Navigator)
20450766 During the induced differentiation of HL-60 cells, WT1 gene expression decreases gradually.
20442690 Data suggest that WT1 mutations are more common in Chinese children with early-onset nephrotic syndrome.
20442690 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20442368 A new WT1 mutation-associated gene-expression signature included CD96 & genes involved in gene regulation, proliferation & metabolism. It deregulates many homeostatic processes. WT1mut CN-AML has a poor treatment response in all ages.
20442368 Observational study of gene-disease association. (HuGE Navigator)
20435628 Wilms tumor 1 mutations are associated with an inferior relapse-free survival in adult acute T-lymphoblastic leukemia.
20435628 Observational study of gene-disease association. (HuGE Navigator)
20413658 85 WT1 mutations were seen in 70 of 842 AML patients, in exons 7,8 & 9. In contrast to other studies, the presence of WT1 mutations has no independent prognostic significance in predicting outcome in pediatric AML.
20413658 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20412098 High WT1 gene expression is associated with acute myeloid leukemia.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20376582 WT1 maybe induces similar graft vs leukemia effects in both acute leukemia and chronic myelocytic leukemia patients early after stem cell transplantation
20368538 Observational study of gene-disease association. (HuGE Navigator)
20368469 WT1 mutations are correlated with poor prognosis in AML patients. The mutation status may be changed in some patients during AML progression.
20368469 Observational study of gene-disease association. (HuGE Navigator)
20332316 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20204298 WT1 promotes estrogen-independent growth and anti-estrogen resistance in ER-positive breast cancer cells presumably through activation of the signaling pathways mediated by the members of EGFR family.
20174665 Screening in Jurkat T-cells with a short-hairpin-RNA (shRNA) library identifies Wilms tumor 1 (WT1) is important for HIV-1 replication. shRNA against WT1 exhibits a decrease on LTR-driven beta-gal transcription compared to control
20150449 Describe an Italian family with isolated focal sgemental glomerulosclerosis associated with a novel sequence variant in WT1 gene exon 9.
20122399 Proteolysis of WT1 by HtrA2 causes the removal of WT1 from its binding sites at gene promoters, leading to alterations in gene regulation that enhance apoptosis.
20092642 Data suggest that defects in antigen presentation caused by loss or mutation of WT1 or downregulation of HLA molecules are not the major basis for escape from the immune response induced by WT1 peptide vaccination.
20038731 Single nucleotide polymorphism in the mutational hotspot of WT1 predicts a favorable outcome in patients with cytogenetically normal acute myeloid leukemia.
20038731 Observational study of gene-disease association. (HuGE Navigator)
20025481 All 97 gastrointestinal stromal tumors were positive for WT-1 and the staining intensity was strong in 59 (60.8%).
20016532 Mutant Wilms' tumor 1 (WT1) mRNA with premature termination codons in acute myeloid leukemia (AML) is sensitive to nonsense-mediated RNA decay (NMD).
20013787 importance of WT1 mutations in acute myeloid leukaemia (review)
19951528 Inhibiting the WT1 expression in K562/A02 cells can enhance the drug sensitivity to adriamycin.
19856421 The combination of MUC5ac and WT-1 stains is useful in distinguishing pancreatic ductal from ovarian serous carcinoma in body fluid cytology.
19847202 Wilms tumor 1 gene mutations are associated with pediatric T-cell malignancies.
19847202 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19817904 we draw the attention of histopathologists to the variable expression of p53, WT1 and hormone receptors in a significant proportion of cases of USC
19811333 The rise of WT1 expression preceded the hematological relapse by approximately 4 months. WT1 expression higher than 20 WT1 copies /10(4)ABL copies after induction & consolidation chemotherapy was associated with shorter survival in acute myeloid leukemia.
19776535 The WT1 mRNA level is a sensitive biomarker for monitoring minimal residual disease.
19752335 greater WT1 transcript reduction after induction combination chemotherapy predicted reduced relapse risk of acute myeloid leukemia
19749460 the high frequency of loss of allelic integrity at Wilms' tumor suppressor gene-1 locus in high-graded breast tumors is associated with aggressiveness of the tumor.
19747485 Regulated WT1 followed by sequential Egr1 and Sp1 binding to elements within Prm1 mediate repression and subsequent induction of TPalpha during differentiation into the megakaryocytic phenotype.
19730683 Observational study of gene-disease association. (HuGE Navigator)
19638168 WT1 in nevi and melanomas. WT1 protein is (a)expressed in cytoplasm of neoplastic cell, (b) increased in advanced stages of melanoma progression, (c) associated with shorter overall survival in melanoma.
19618455 Neither overall survival nor event-free survival was correlated with WT1 expression in 155 pediatric AML patients
19615003 WT1 is not sufficient for distinguishing melanoma from melanocytic nevi.
19605546 Impaired WT1/Cre-binding protein interplay in addition to advanced glycation end products suppress podocalyxin expression in high glucose-treated human podocytes.
19578047 Our results support the combined role of WT1 and nestin in glial tumorigenesis and progression.
19549856 WT1 interference with Wnt signaling represents an important mode of its action relevant to the suppression of tumor growth and guidance of development.
19536888 Observational study of gene-disease association. (HuGE Navigator)
19494353 WT1 mutations present in T-ALL are predominantly heterozygous frameshift mutations resulting in truncation of the C-terminal zinc finger domains of this transcription factor. WT1 mutations do not confer adverse prognosis in pediatric and adult T-ALL.
19443388 expression level of WT1 was found to be a significant predictor of endometrial cancer relapse
19437143 There is no evidence that WT1 does regulate the Wnt-4/beta-catenin-independent pathway which is activated in the Pit-1-expressing subset of pituitary adenomas.
19416806 WTX binds WT1 and enhances WT1-mediated transcription, suggesting a role for WTX in nuclear pathways implicated in the transcriptional regulation of cellular differentiation programs
19407365 Finding suggest that WT-1 immunohistochemistry may be used to assess both the ME cells and micro-vessel density.
19404640 Data show that WT1 expression levels were low in mature B-ALL and highest in ALL cases with co-expression of myeloid markers, making it a useful therapeutic target molecule in adult ALL with the exception of mature B-ALL.
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19322206 Pediatric AML samples harboring WT1 gene mutations in exon 7 revealed significantly higher WT1 expression compared with that of wild-type samples.
19321755 The authors show that virus infection results in the profound upregulation of Wilms' Tumour 1 (WT1) protein, a transcription factor associated with the negative regulation of a number of growth factors and growth factor receptors, including EGFR.
19250757 Case report. Malignant mesothelioma of the tunica vaginalis expressing Wilms tumor-1 protein, CD138, the expression of which could help in confirming the histopathological diagnosis and in targeting therapy.
19236519 Wilms' tumour gene 1 (WT1) positivity in endothelial cells surrounding epithelial uterine tumours
19221039 WT1 mutations witn /FLT3-internal tandem repeat positive are associated with acute myeloid leukemia.
19221039 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19212333 results suggest that GATA-1 and/or GATA-2 binding to a GATA site of the 3' enhancer of WT1 played an important role in WT1 gene expression
19190340 WT1 gene is expressed in a substantial proportion of hepatocellular carcinoma cell lines contributing, to tumor progression and resistance to chemotherapy.
19171881 WT1 mutations occur at a significant rate in childhood acute myeloid leukemia and are a novel independent poor prognostic marker
19171881 Observational study of gene-disease association. (HuGE Navigator)
19169475 Constitutional abnormalities of WT1 cause gonadal and renal anomalies and predisposition to neoplasia
19141860 Observational study of gene-disease association. (HuGE Navigator)
19137020 Mutations in WT1 gene is associated with Wilms tumor.
19120973 These results indicate WT1 protein-derived 16-mer natural peptide, WT1(332) (KRYFKLSHLQMHSRKH) is a promiscuous WT1-specific helper epitope.
19099861 The abnormal ratio of +KTS/-KTS isoforms caused by WT1 mutations along with abnormal expression of podocyte molecules were involved in the pathogenesis of proteinuria.
19097357 Expression of the WT1 gene product was found in all tumor samples but no statistically significant correlations between WT1 expression and histologic type
19067769 These data establish WT1 as a critical repressor of thromboxane A2 receptor promoter Prm1, suppressing TPalpha expression.
19017365 Gynaecologic epithelial histologic type is regulated by WT1 expression through its selective repression of HOX genes.
18972317 WT1 protein was not detected in the nasal NK/T-cell lymphoma
18950857 quantified both WT1 and PRAME transcript levels in the bone marrow of AML patients. Dynamic patterns of WT1 and PRAME during follow-up showed that a consistent elevation or a rise over time to exceed the normal range predicted clinical relapse
18929401 Although WT1 is expressed in a majority of endometrial carcinomas, a heterogeneous staining pattern is observed.
18801058 cases with increase of WT1 levels after hematopoietic stem cell transplant and without graft vs. host disease may be candidate to discontinuation of immunosuppression and/or donor lymphocyte infusion therapy
18756326 observation that TIA-1 and WT1 are both involved in apoptosis supports our proposal for a functional link between these proteins
18752126 Nuclear WT1 expression is present in a minority of endometrioid ovarian carcinomas
18751389 WT1 plays an important role in maintaining normal growth of mammary epithelial cells and dysregulated WT1 expression may contribute to breast cancer development.
18722603 Innervation of deep endometriosis has been linked to its severe pain symptoms. Wilms' tumor gene 1 is overexpressed in part of these nerves.
18708366 This study clearly implicates WT1 as a mediator of antiestrogen resistance in breast cancer through down-regulation of ERalpha expression.
18703217 Herein, we describe a desmoplastic small round cell tumor of soft tissue with an unusual pattern of WT1 expression associated with a novel variant EWS-WT1 fusion transcript.
18688870 Maternal transmission of a mutation in exon 1 of the WT1 gene caused genitourinary anomalies.
18666806 Loss of WT1 permits aberrant PAX3 expression in a subset of Wilms tumors with myogenic phenotype.
18644985 WT1 transactivates another important negative regulator of the Ras/MAPK pathway, MAPK phosphatase 3 (MKP3).
18618575 Observational study of gene-disease association. (HuGE Navigator)
18604725 expression of ROR1 and WT1 in B-ALL is associated with the differentiation stage of the leukemic cells
18591546 WT1 mutations are a negative prognostic indicator in normal karyotype AML and may be suitable for the development of targeted therapy
18590714 The expression levels of WT1 and NPM1 in 93 paired samples showed a strong positive correlation. WT1 decreased rapidly after induction but maintained these residual levels after treatment in patients in complete remission.
18559874 The presence of WT1 mutations at diagnosis of acute myeloid leukemia is associated with extremely poor outcome, higher risk of relapse and death.
18559874 Observational study of gene-disease association. (HuGE Navigator)
18528287 Overexpressed in gastrointestinal stromal tumor and some smooth muscle tumors.
18516627 A novel Wilms' tumor 1 gene mutation in a child with severe renal dysfunction and persistent renal blastema.
18469795 None of the breast carcinoma subtype unassociated with mucinous component showed WT1 expression.
18466223 study shows that WT1 is expressed de novo in numerous neuroepithelial tumours and increases with the grade of malignancy; results suggest an important role of WT1 in tumourigenesis and progression in brain tumours
18464243 three WT1 subtypes were correlated with WT1, IGF2, and CTNNB1 genetics
18443273 WT1 may have a role in relapse of acute myeloid leukemia
18425046 WT1 is a fairly specific marker for spindle cell tumors of gynecologic organs, including ovarian spindle cell tumors, endometrial stromal tumors, and uterine smooth muscle tumors. Non-GYN spindle cell sarcomas rarely express WT1.
18424770 activation of the EpoR gene by Wt1 may represent an important mechanism in normal hematopoiesis
18385267 Recent advances including the development of transgenic mouse models and conditionally immortalized podocyte cell lines are beginning to shed light on WT1's crucial role in podocyte function[review]
18371184 WT1 expression in astrocytes indicates a neoplastic origin and might represent an important diagnostic tool to differentiate reactive from neoplastic astrocytes by immunohistochemistry.
18311776 WT1 and WTX mutations occur with similar frequency, that they partially overlap in Wilms tumors, and that mutations in WT1, WTX, and CTNNB1 underlie the genetic basis of about one-third of Wilms tumors
18292948 WT1-shRNA targeting exon 5 should serve as a potent anti-cancer agent for various types of solid tumors.
18273617 Biallelic loss (the novel germline mutation c.895-2A > G & one LOH in the tumor) of the WT1 gene was associated with drug-resistant bilateral Wilms tumor.
18271004 Critical levels of WT1 + KTS, SRY and SOX9 are required for normal Sertoli cell maturation, and subsequent normal spermatogenesis.
18260155 Upregulation of Wilms tumor gene protein 1 is associated with ovarian cancer metastasis and modulates cell invasion
18255279 The expression of WT1 is increased more in HCC than in non-tumour tissues. Overexpressed WT1 was associated with tumour growth, and resulted in a worsening prognosis of HCC. WT1 overexpression might contribute to oncogenic potential.
18231915 WT1 expression in newly diagnosed and relapsed ALL patients was significantly higher than that of the ALL patients at remission and normal subjects
18231640 WT1 induction led to strong induction of IFI16 expression and its promoter activity was responsive to the WT1 protein.
18212735 transcriptional activation of ETS-1 by the Wilms' tumour suppressor WT1 is a crucial step in tumour vascularization via regulation of endothelial cell proliferation and migration.
18202757 the -KTS-containing variants of WT1 are directly involved in the regulation of p21(Waf1/Cip1) expression and the subsequent suppression of lymph node metastasis in human lung squamous cell carcinoma
18181329 The researchers found that the Wilms tumor gene 1 is very important in the survival of the breast cancer MCF-7 cell line.
18094593 Relapse was observed in eight of 17 patients with acute myelogenous leukemia analysed longitudinally, and an increase of WT1 gene expression preceded morphologic relapse in four patients.
18081724 Bone marrow WT1 gene expression analysis is informative only in cases where a more sensitive minimal residual disease (MRD) marker is not available.
18065803 Mutations in two other genes WT1 and LAMB2 may also cause IDMS.
18064689 In pleural malignant effusion, malignant mesothelioma can be identified with positive staining for WT-1 and negative staining for p63.
18064385 This study provides further insight into the mechanisms of transcriptional regulation of the WT1 gene and WT1-associated diseases treatment.
18058136 Observational study of genotype prevalence. (HuGE Navigator)
18042071 Nuclear WT1 expression is present in a minority of invasive micropapillary carcinomas and, when present, expression is focal
18034345 Pure curcumin decreased WT1 gene expression in both transcriptional and translational levels.
17972942 WT1 downregulation during myeloid differentiation of NB4 and HL60 leukemic cell lines is associated with increased tumor repressor hDMP1 mRNA levels
17956689 The WT1 enhancer promotes the transcriptional activities of WT1 promoter in some cell lines regardless of the hematopoietic tissue origin.
17947653 enhanced tetramer binding of modified WT1-T-Cell Receptor variants was not associated with improved WT1-specific T cell function
17940140 WT1 encodes conserved antisense RNAs that may have an important regulatory role in WT1 expression via RNA:RNA interactions, and which can become deregulated by a variety of mechanisms in cancer.
17939399 WT1 gene expression and isomer ratio changes during phorbol ester induced differentiation of K562 cells.
17934764 NPHS2 and WT1 are now known to be genes commonly involved in the pathogenesis of sporadic steroid-resistant nephrotic syndrome. However, the incidence of NPHS2 gene mutation shows interethnic difference.
17912546 direct role of WT1 in melanoma proliferation, which might be mediated via Nestin and Zyxin
17886559 Tumors that contained wild-type p53 were significantly more likely to express WT1, and presence of WT1 in glioma support that WT1 expression is important in glioma biology.
17869219 We conclude that WT1 might be an important component of the NO-dependent regulation of T lymphocyte proliferation and potential function.
17853480 report on eight new cases of this condition, two of whom were shown to have heterozygous missense mutations in the C-terminal zinc finger domains of WT1: Arg366Cys and Arg394Trp
17803653 There was no significant difference in WT1 message between aplastic anemia and refractory anemia, suggesting that WT1 message is not a good tool to discriminate these two diseases.
17728783 WT1 expression is induced by oncogenic signalling from BCR/ABL1. WT1 contributes to resistance against apoptosis induced by imatinib.
17721194 WT1 is useful for the distinction of ovarian Sertoli cell tumor from endometrioid tumors and carcinoids.
17716689 Data report the structure determination by both X-ray crystallography and NMR spectroscopy of the WT1 zinc finger domain in complex with DNA.
17706117 Promoter methylation does not silence the mRNA expression of WT1 during the development of breast cancer.
17688410 These results show that the expression of the NDRG2 gene is directly or indirectly induced by WT1, and provide the first insights into transcriptional regulation of the NDRG2 gene, including demonstration of a novel splice variant.
17665418 There was a significantly lower level of WT-1 expression in parathyroid tumours than in normal parathyroid glands. Abnormal expression of WT-1 and the IGF axis may play a role in the pathogenesis of hyperparathyroidism.
17630404 Wilms tumour was not observed in any aniridia case without a WT1 deletion. Of those with WT1 deletions, 77% with submicroscopic deletions (detectable only by high-resolution FISH analysis) had Wilms tumour compared with 42.5% with visible deletions.
17605875 WT1 expression in normal bone marrow decreases gradually with cell differentiation.
17599043 An important early target of progestins that regulates both proliferation and differentiation in breast cancer cells.
17579045 WT1 is a repressor of matrix metalloproteinase-9, regulated by a nitric oxide/soluble guanylate cyclase-dependent pathway in human lung epithelial cells.
17551084 Bilateral Wilms tumours showed loss of the wild type WT1 allele (loss of heterozygosity (LOH)) and a tumour specific mutation in catenin beta1 (CTNNB1).
17541636 WT1 mutation analysis should be routinely done in females with steroid-resistant nephrotic syndrome.
17540436 Survival analysis stratified by FIGO stage performed on cases using a 10% cut-off showed a shorter disease specific survival in patients with a positive WT1 expression in the ovarian tumor tissue.
17531467 WT1 is overexpressed in uterine sarcomas. Since increased levels of mRNA determine the biological role, WT1 might contribute to uterine sarcoma tumour biology.
17524167 REVIEW of the isoform-specific effects of WT1 on target gene expression and over-representation of certain isoforms in leukaemia
17508006 distinguish between idiopathic hypereosinophilic syndromes/chronic eosinophilic leukemia and reactive hypereosinophilia based on WT1 transcript amount
17496156 A functional interaction of WT1 and AR might play a role during the development of the male external genitalia.
17487399 These studies of VEGF regulation by WT1 and dysregulation by DDS(R384W) suggest an important role for WT1 in both normal and tumor-related angiogenesis.
17371932 Observational study of genotype prevalence. (HuGE Navigator)
17216259 study suggests mutations in NPHS2 & WT1 are not a cause of uncomplicated steroid sensitive nephrotic syndrome or frequently relapsing & steroid-dependent nephrotic syndrome(FRNS/SDNS)
17210670 Failure of methylation spreading at the WT1 antisense regulatory region early in renal development, followed by imprint erasure, occurs during Wilms' tumourigenesis.
17206472 WT1 overexpression did not protect against p53-mediated apoptosis or ionizing radiation induced cell death. WT1 siRNA increased the radiosensitivity of two human glioma cell lines independently of p53.
17205055 8 mutations were found in WT1 in Wilms tumor patients, mostly in exons 7 and 9, the DNA binding domain. Adverse outcome correlated with these mutations in patients with FLT3-ITD.
17160023 WT1 could function to either promote or suppress a transformed phenotype
16990584 dMolecular profiling of CD34(+) cells uncover a limited number of genes such as WT1 with altered expression that are associated with patients' clinical characteristics and may have potential prognostic application.
16987884 role of WT1 in different diseases and normal development--review
16966277 The induction of apoptosis by arsenic compounds was accompanied by down-regulation of hTERT and wt1 mRNA and protein expression but up-regulation of par-4.
16934801 WT1 interacts with the novel splicing regulator RNA binding protein RBM4, further, the longer isoform of WT1 is able to inhibit the effect of RBM4 on alternative splicing.
16927106 The WT1 gene encodes a zinc finger transcription factor involved in kidney and gonadal development and, when mutated, in the occurrence of kidney tumor and glomerular diseases.
16924231 These findings increase our knowledge of how WT1 exerts its transcriptional regulatory role and suggests that hnRNP-U may be a candidate Wilms' tumour gene at 1q44.
16920711 transcriptional activation of the alpha4integrin gene by Wt1(-KTS) might contribute to normal formation of the epicardium and other tissues in the developing embryo
16909243 Observational study of genotype prevalence. (HuGE Navigator)
16909243 WT1 splice mutations are not rare in females under 18 years with steroid resistance (SRNS). This occurs in absence of a clear renal pathology picture and frequently in absence of phenotype change typical of Frasier syndrome.
16883592 higher WT1 expression was associated with favorable cytogenetics subtypes and accordingly with better outcome in children with acute myeloid leukemia
16876863 High levels of WT1 expression is associated with childhood acute leukemia
16857797 WT1 may have a role in very poor survival of patients with osteogenic sarcoma metastasis
16828156 The WT1 expression seems to be modulated by the presence of cytokines, especially on day 20 of culture.
16780544 Posttransplant recurrence of proteinuria in a case of focal segmental glomerulosclerosis is associated with WT1 mutation
16518414 Isoforms of WT1 play antiapoptotic roles at some points upstream of the mitochondria in the intrinsic apoptosis pathway.
16502587 Method for the quantification of WT1 transcript by real-time polymerase chain reaction in acute myeloid leukemia and myelodysplastic syndromses.
16467207 Binding of the transcriptionally competent Wt1(-KTS) isoform to the minimal EPO promoter was demonstrated; this promoter was activated up to 20-fold by transient cotransfection of Wt1(-KTS) in different cell lines.
16260903 Podocyte-specific expression of HIV-1 Nef induces loss of synaptopodin and WT1, and expression of Ki-67 in podocytes, which is essential for the dedifferentiation and proliferation of podocytes in HIV-associated nephropathy
16087727 interplay between WT1 and ERalpha in control of IGF-IR gene transcription
15982325 Data suggest that WT1 protein expression is maintained during angiogenesis and malignant transformation of endothelial cells and can be considered as a new endothelial marker.
15957141 A novel familial WT1 point mutation in the stop codon of exon 10 (1730A/G; X450W) ws found in 3 members of a family with Wilms tumor and nephropathy.
15927676 Human transgenic Wt1 is not essential for murine hematopoiesis and that there may be significant differences in its role between mouse and man.
15894924 frequently detected in the cytoplasm of a subset of high-grade non-Hodgkin lymphomas
15878620 The WT1 Genes were determined in bone marrow samples of children with de novo B-lineage (n=170) and T-lineage (n=25) acute lymphoblastic leukemia (ALL).
15845894 describe WT1-specific and HLA class II-restricted CD4+ T lymphocytes possessing direct cytotoxic activity against leukemia cells
15838390 Observational study of gene-disease association. (HuGE Navigator)
15780077 No mutations detected in Japanese congenital nephrotic synddrome patients.
15696971 the WT1 gene may play an important role in the tumorigenesis of glioblastoma, in contrast to medulloblastoma
15687485 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15674342 WT1 protein plays a vital role in regulating cell cycle progression and apoptosis in HER2/neu-overexpressing breast cancer cells.
15661271 WT1 mRNA levels were indicative for hematologic relapse (n = 6) versus response in CML patients
15540161 WT1 gene is strongly overexpressed in beta-catenin mutant desmoid tumors.
15538407 Th1-biased cellular immune responses against WT1 protein should be elicited in patients with hematopoietic malignancies.
15534117 WT1 protein is processed and expressed in the context of HLA class I molecules similarly on both myeloma and lymphoma cells
15510596 WT1 mRNA was overexpressed in all of the 12 esophageal squamous cell carcinomas examined.
15506928 Mchanism of action of the WT1 suppression domain, and its function in the context of the role of WT1 as a regulator of development.
15504938 Recombinant WT1 protein can bind and activate the 186-bp NPHS1 fragment in a sequence-specific manner. WT1 may be required for regulation of the NPHS1 gene in vivo.
15504250 These results may indicate that the W T1 gene plays an important role in tumorigenesis of primary astrocytic tumors.
15483024 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15365188 WT1 vaccination could induce WT1-specific cytotoxic T lymphocytes and result in cancer regression without damage to normal tissues.
15339675 WT1/beta-glucuronidase ratio is a prognostic factor for predicting relapse in patients with acute myeloid leukemia and could be included to establish more defined risk groups.
15297187 WT1 is expressed in appreciable numbers of endometrial cancers.
15286719 overexpression of WT1 induced a significant increase in the abundance of endogenous c-myc protein in breast cancer cells, consistent with the upregulation of c-myc transcription following WT1 induction.
15266301 Observational study of gene-disease association. (HuGE Navigator)
15253707 Observational study of gene-disease association. (HuGE Navigator)
15253707 mutations in the WT1 have been found to be present in patients with SRNS in association with Wilms' tumor (WT) and urinary or genital malformations, as well as in patients with isolated steroid resistant nephrotic syndrome
15223639 WT1 levels at presentation correlate with several biologic features of leukemia
15150775 Observational study of gene-disease association. (HuGE Navigator)
15084838 WT1 expression in epithelial tumors of the female genital tract may be related to cell differentiation and histologic subtypes of carcinomas, rather than to primary site of origin
14988155 Cytotoxic T lymphocytes display strong cytotoxic activity against leukemia cells expressing WT1 endogenously but not against WT1(-) human tumor cells.
14988020 The transcription factor PEA3 activates the WT1 promoter.
14962262 Co-expression of this gene with MDR1 did not significantly influence the complete response rate to induction therapy.
14767530 WT1 has a role in suppressing prostate tumor cell growth
14701728 BASP1 can confer WT1 cosuppressor activity in transfection assays, and elimination of endogenous BASP1 expression augments transcriptional activation by WT1.
14681303 There is a molecular basis for the strong bias of paternal allele mutations and variable penetrance observed in syndromes with inherited WT1 mutations.
14666652 WT1 inhibits the transformed phenotype of breast cancer cells and down-regulates the beta-catenin/TCF signaling pathway through destabilization of beta-catenin.
12970737 These results suggest that WT1 forms a complex with SRY to regulate transcription and that this WT1-SRY interaction is important in testis development.
12961083 WT1 was restricted to nucleus of glomerular podocytes.
12960088 WT1 gene is novel downstream target for IGF-I action. Reduced levels of WT1 may facilitate IGF-I-stimulated cell cycle progression. Inhibition of WT1 gene expression by IGF-I be significant in cancer initiation and/or progression.
12914969 Wilms' tumor suppressor is a mediator of neuronal degeneration associated with the pathogenesis of Alzheimer's disease.
12901797 Expression of WT1 protein was detected in 41 (89%) of 46 cases of colonic and rectal adenocarcinoma.
12841869 findings indicate an important role of the wild-type WT1 gene in the tumorigenesis of primary thyroid cancer
12841384 evidence demonstrating that the WT1 gene is involved in the development and differentiation of T-lineage cells
12829997 WT1 is reexpressed in the cirrhotic liver in relation to disease progression and may play a role in the development of hepatic insufficiency in cirrhosis.
12824921 Overexpressed in human bone and soft-tissue sarcomas.
12824878 Overexpression of the Wilms' tumor gene WT1 is associated with head and neck squamous cell carcinoma
12761165 Epigenetic silencing of WT1 by promoter hypermethylation with loss of heterozygosity is consistent with the revised two-hit model in Wilms' tumorigenesis.
12681485 role in regulating taurine transporter gene
12665546 Alternative splicing, RNA editing, and the use of alternative translation initiation sites generate a multitude of isoforms, which seem to have overlapping but also distinct functions during embryonic development and the maintenance of organ function.
12471221 Correlation between a specific Wilms tumour suppressor gene (WT1) mutation and the histological findings in Wilms tumour (WT)
12444079 Interacts with p53 in insulin-like growth factor-I receptor gene regulation
12411326 Two distinct HLA-A0201-presented epitopes of the Wilms tumor antigen 1 can function as targets for leukemia-reactive CTL
12239212 Results suggest that bone marrow zinc finger 2 (BMZF2) interferes with the transactivation potential of Wilms tumor suppressor gene (WT1).
12213901 WT1 and DAX-1 inhibit aromatase P450 expression in human endometrial and endometriotic stromal cells
12200377 CD8 T-cell responses to Wilms tumor gene product WT1 and proteinase 3 were observed in patients with acute myeloid leukemia, and not in controls.
12199781 abnormal WT1 expression may contribute to the disturbed differentiation of haaematopoietic cells in MDS patients
12161615 WT1 missense mutations in exon 7, which affect zinc finger 1, alter not only renal function but also male gonadal development in a patient with Denys-Drash syndrome and a 46,XY karyotype.
12133898 The retinoblastoma-derived human cell line, Y-79, contained robust amounts of Wt1 mRNA and protein. Wt1 expression was down-regulated upon laminin-induced differentiation of Y-79 into neuron-like cells.
12127961 WT1 protein contributes to breast cancer progression by promoting breast cancer cell proliferation
12111123 A peptide representing positions 124-148 of the Kruppel-like zinc finger protein was predicted to bind to the HLA-DRB1*0401 molecule. Its sequence is PQQMGSDVRDLNALL.
12070003 quantitation of WT1 RNA in Japanese patients with paroxysmal nocturnal hemoglobinuria
11986946 The coexpression of the apoptosis-related genes bcl-2 and wt1 in predicting survival in adult acute myeloid leukemia.
11960373 Induction of the interleukin-2/15 receptor beta-chain by the EWS-WT1 translocation product.
11939727 uterine papillary serous carcinomas were nonreactive for WT1
11933209 A review of the phenotypic variation due to the Denys-Drash syndrome-associated germline WT1 mutation R362X
11919196 Cyclin E is a target of WT1 transcriptional repression
11912180 reduced expression of WT1 causes crescentic glomerulonephritis and mesengial sclerosis and thus a regulator of podocyte function
11889045 requirement for Wt1 in normal retina formation with a critical role in Pou4f2-dependent ganglion cell differentiation.
11738793 review: role in testis descent
9361029 WT1 gene is expressed from the paternal allele in fibroblasts and lymphocytes.
8621495 Use of non-AUG (CUG) translation initiation site upstream of, and in-frame with the first AUG, generates longer WT1 isoforms.
8012395 WT1 gene exhibits complex tissue-specific and polymorphic imprinting pattern.

AA Sequence

MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAPPPPPPPPPHS      1 - 70
FIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLES     71 - 140
QPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCT    141 - 210
GSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPI    211 - 280
LCGAQYRIHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGE    281 - 350
KPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPS    351 - 420
CQKKFARSDELVRHHNMHQRNMTKLQLAL                                             421 - 449
//

Text Mined References (542)

PMID Year Title
26997404 2016 WT1 mutations in steroid-resistant idiopathic nephrotic syndrome.
26721227 2016 Wilms tumor protein 1 (WT1)-- not only a diagnostic but also a prognostic marker in high-grade serous ovarian carcinoma.
26686990 2016 The roadmap of WT1 protein expression in the human fetal heart.
26686553 2015 A genome-wide association study identifies four novel susceptibility loci underlying inguinal hernia.
26655220 2016 Wilms Tumor Suppressor, WT1, Cooperates with MicroRNA-26a and MicroRNA-101 to Suppress Translation of the Polycomb Protein, EZH2, in Mesenchymal Stem Cells.
26644203 2016 A systematic review and meta-analysis of the impact of WT1 polymorphism rs16754 in the effectiveness of standard chemotherapy in patients with acute myeloid leukemia.
26597595 2016 A 4-gene expression score associated with high levels of Wilms Tumor-1 (WT1) expression is an adverse prognostic factor in acute myeloid leukaemia.
26573232 2016 A genome-wide association study identifies WT1 variant with better response to 5-fluorouracil, pirarubicin and cyclophosphamide neoadjuvant chemotherapy in breast cancer patients.
26531831 2016 WT1 Expression in Adult Acute Myeloid Leukemia: Assessing its Presence, Magnitude and Temporal Changes as Prognostic Factors.
26514528 2015 Assessment of Relationship between Wilms' Tumor Gene (WT1) Expression in Peripheral Blood of Acute Leukemia Patients and Serum IL-12 and C3 Levels.
26512748 2015 HuR antagonizes the effect of an intronic pyrimidine-rich sequence in regulating WT1 +/-KTS isoforms.
26499507 2016 The Wilms Tumor-1 (WT1) rs2234593 variant is a prognostic factor in normal karyotype acute myeloid leukemia.
26482175 2016 WT1 expression is inversely correlated with MYCN amplification or expression and associated with poor survival in non-MYCN-amplified neuroblastoma.
26429162 2015 Real-time quantitative PCR detection of WT1 and M-BCR-ABL expressions in chronic myeloid leukemia.
26408240 2015 AJKD Atlas of Renal Pathology: Diffuse Mesangial Sclerosis.
26406403 2015 Clinicopathological significance and prognostic value of Wilms' tumor gene expression in colorectal cancer.
26371248 2015 Fibrocytes Regulate Wilms Tumor 1-Positive Cell Accumulation in Severe Fibrotic Lung Disease.
26358501 2015 Novel WT1 Missense Mutations in Han Chinese Women with Premature Ovarian Failure.
26320177 2015 WT1-mediated repression of the proapoptotic transcription factor ZNF224 is triggered by the BCR-ABL oncogene.
26238466 2015 Epigenetic Changes in the Methylation Patterns of KCNQ1 and WT1 after a Weight Loss Intervention Program in Obese Stroke Patients.
26224397 2015 Wilms tumor gene single nucleotide polymorphism rs16754 predicts a favorable outcome in children with acute lymphoblastic leukemia.
26221900 2015 Comparison of minimal residual disease (MRD) monitoring by WT1 quantification between childhood acute myeloid leukemia and acute lymphoblastic leukemia.
26200099 2015 Microcystic Stromal Tumor: A Distinctive Ovarian Sex Cord-Stromal Neoplasm Characterized by FOXL2, SF-1, WT-1, Cyclin D1, and ?-catenin Nuclear Expression and CTNNB1 Mutations.
26150159 2015 WT1 expression in the human fetus during development.
26138637 2015 WT1 Expression in Circulating RNA as a Minimal Residual Disease Marker for AML Patients After Stem-Cell Transplantation.
26090994 2015 Identification of a Novel C-Terminal Truncated WT1 Isoform with Antagonistic Effects against Major WT1 Isoforms.
26037530 2016 WT1 and interferon-?-vitamin D association in MS: a longitudinal study.
26012361 2015 Combined assessment of WT1 and BAALC gene expression at diagnosis may improve leukemia-free survival prediction in patients with myelodysplastic syndromes.
25929687 2015 Wilms' tumor gene 1 regulates p63 and promotes cell proliferation in squamous cell carcinoma of the head and neck.
25881478 Wilms tumor 1 (WT1) protein: Diagnostic utility in pediatric tumors.
25858532 Wilms' tumor 1 (WT1) protein expression in human developing tissues.
25841655 2015 Wilms Tumor 1 rs16754 predicts favorable clinical outcomes for acute myeloid leukemia patients in South Chinese population.
25800978 Oncofetal expression of Wilms' tumor 1 (WT1) protein in human fetal, adult and neoplastic skeletal muscle tissues.
25794157 2015 Hypoxia-sensitive epigenetic regulation of an antisense-oriented lncRNA controls WT1 expression in myeloid leukemia cells.
25773860 2015 The density of microvessels positive for Wilms' tumour-1 protein (WT-1) is an independent predictor of recurrence risk in meningiomas.
25758068 2015 The level of bone marrow WT1 message is a useful marker to differentiate myelodysplastic syndromes with low blast percentage from cytopenia due to other reasons.
25748047 2015 Wilms' tumor 1 (WT1) expression and prognosis in solid cancer patients: a systematic review and meta-analysis.
25714774 2015 Does the level of WT1 expression predict the outcome in Philadelphia-negative myeloproliferative neoplasms?
25688735 2015 A high incidence of WT1 abnormality in bilateral Wilms tumours in Japan, and the penetrance rates in children with WT1 germline mutation.
25613309 2015 WT1 enhances proliferation and impedes apoptosis in KRAS mutant NSCLC via targeting cMyc.
25601757 2015 WT1 recruits TET2 to regulate its target gene expression and suppress leukemia cell proliferation.
25572170 2015 Prognostic significance of diagnosed WT1 level in acute myeloid leukemia: a meta-analysis.
25510679 2014 The Wilms' tumour suppressor Wt1 is a major regulator of tumour angiogenesis and progression.
25498507 2015 Optimal time-points for minimal residual disease monitoring change on the basis of the method used in patients with acute myeloid leukemia who underwent allogeneic stem cell transplantation: a comparison between multiparameter flow cytometry and Wilms' tumor 1 expression.
25482556 2014 DNA hydroxymethylation profiling reveals that WT1 mutations result in loss of TET2 function in acute myeloid leukemia.
25474318 2014 Wilms' tumor gene 1 (WT1) silencing inhibits proliferation of malignant peripheral nerve sheath tumor sNF96.2 cell line.
25460359 2015 Wilms tumor gene 1 expression as a predictive marker for relapse and survival after hematopoietic stem cell transplantation for myelodysplastic syndromes.
25454478 2015 Low-grade small round cell tumor of the cauda equina with EWSR1-WT1 fusion and indolent clinical course.
25451826 2015 The mutational spectrum of WT1 in male infertility.
25447528 2014 Wilms' tumor 1 enhances Cisplatin-resistance of advanced NSCLC.
25426668 2015 Prognostic importance of expression of the Wilms' tumor 1 gene in newly diagnosed acute promyelocytic leukemia.
25418835 2015 Wilms' tumor gene WT1 promotes homologous recombination-mediated DNA damage repair.
25416956 2014 A proteome-scale map of the human interactome network.
25398938 2015 Mutant WT1 is associated with DNA hypermethylation of PRC2 targets in AML and responds to EZH2 inhibition.
25391383 2015 Genetic variation in imprinted genes is associated with risk of late-onset Alzheimer's disease.
25387409 2015 Monitoring of WT1 and its target gene IRF8 expression in acute myeloid leukemia and their significance.
25331950 2015 Wilms tumor suppressor, WT1, suppresses epigenetic silencing of the ?-catenin gene.
25312909 2015 Modulating effects of WT1 on interferon-?-vitamin D association in MS.
25310451 2014 Role of the Wilms' tumor 1 gene in the aberrant biological behavior of leukemic cells and the related mechanisms.
25258363 2014 Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
25243629 2015 Real-time assessment of relapse risk based on the WT1 marker in acute leukemia and myelodysplastic syndrome patients after hematopoietic cell transplantation.
25238704 2015 Prognostic impact of WT1 expression prior to hematopoietic stem cell transplantation in children with malignant hematological diseases.
25232865 2014 WT1 interacts with MAD2 and regulates mitotic checkpoint function.
25202702 2014 Peripheral blood WT1 expression predicts relapse in AML patients undergoing allogeneic stem cell transplantation.
25145932 2015 A novel missense mutation of Wilms' Tumor 1 causes autosomal dominant FSGS.
25110071 2015 WT1 mutations are secondary events in AML, show varying frequencies and impact on prognosis between genetic subgroups.
25062258 2014 Immunolabeling for p16, WT1, and Fli-1 in the assignment of growth phase for cutaneous melanomas.
25033726 2014 The frequency and significance of WT-1 expression in serous endometrial carcinoma.
25026998 2014 Prognostic significance of WT1 expression in soft tissue sarcoma.
25026287 2014 MRD assessed by WT1 and NPM1 transcript levels identifies distinct outcomes in AML patients and is influenced by gemtuzumab ozogamicin.
25005570 2014 Cytoplasmic expression of Wilms tumor transcription factor-1 (WT1): a useful immunomarker for young-type fibromatoses and infantile fibrosarcoma.
24966966 2014 Diagnostic utility of WT-1 cytoplasmic stain in variety of vascular lesions.
24954546 2014 Wilms' tumor gene 1 transcript levels in leukapheresis of peripheral blood hematopoietic cells predict relapse risk in patients autografted for acute myeloid leukemia.
24934812 2014 EWS-WT1 oncoprotein activates neuronal reprogramming factor ASCL1 and promotes neural differentiation.
24927120 2014 Mechanisms of transcriptional regulation by WT1 (Wilms' tumour 1).
24894814 2014 Exogenous expression of WT1 gene influences U937 cell biological behaviors and activates MAPK and JAK-STAT signaling pathways.
24893204 2014 Characterization of the Zn(II) binding properties of the human Wilms' tumor suppressor protein C-terminal zinc finger peptide.
24856380 2014 Retrospective mutational analysis of NPHS1, NPHS2, WT1 and LAMB2 in children with steroid-resistant focal segmental glomerulosclerosis - a single-centre experience.
24810959 2014 WT1 regulates angiogenesis in Ewing Sarcoma.
24784346 2014 Wilms' tumor gene 1 immunotherapy in pelvic gynecological malignancies.
24778040 2014 High levels of Wilms' tumor 1 (WT1) expression were associated with aggressive clinical features in ovarian cancer.
24713986 2014 Wilms tumor: an update.
24667279 2014 Overexpression of Wilms tumor 1 gene as a negative prognostic indicator in acute myeloid leukemia.
24633336 2014 P53, hTERT, WT-1, and VEGFR2 are the most suitable targets for cancer vaccine therapy in HLA-A24 positive pancreatic adenocarcinoma.
24619359 2014 Classification of a frameshift/extended and a stop mutation in WT1 as gain-of-function mutations that activate cell cycle genes and promote Wilms tumour cell proliferation.
24607494 2014 WT1 expression increases with malignancy and indicates unfavourable outcome in astrocytoma.
24596380 2014 Correlation of Wilms' tumor 1 isoforms with HER2 and ER-? and its oncogenic role in breast cancer.
24534946 2014 Frequent hypermethylation of a CTCF binding site influences Wilms tumor 1 expression in Wilms tumors.
24503937 2014 Proteomics analysis of siRNA-mediated silencing of Wilms' tumor 1 in the MDA-MB-468 breast cancer cell line.
24503796 Insulin-like growth factor I regulates the expression of isoforms of Wilms' tumor 1 gene in breast cancer.
24413855 Steroid-resistant nephrotic syndrome: impact of genetic testing.
24405639 2014 Hypermethylation of the alternative AWT1 promoter in hematological malignancies is a highly specific marker for acute myeloid leukemias despite high expression levels.
24402088 2014 Genotype-phenotype associations in WT1 glomerulopathy.
24393438 2014 Adoptive transfer of genetically engineered WT1-specific cytotoxic T lymphocytes does not induce renal injury.
24374862 2014 WT1 overexpression affecting clinical outcome in non-hodgkin lymphomas and adult acute lymphoblastic leukemia.
24373193 2013 Prognostic significance of RSPO1, WNT1, P16, WT1, and SDC1 expressions in invasive ductal carcinoma of the breast.
24338413 2013 Wilms' tumor suppressor gene mutations in girls with sporadic isolated steroid-resistant nephrotic syndrome.
24323466 2014 Expression of Wilms' tumor gene (WT1) is associated with survival in malignant pleural mesothelioma.
24321497 2013 The oncogenic properties of EWS/WT1 of desmoplastic small round cell tumors are unmasked by loss of p53 in murine embryonic fibroblasts.
24265486 2014 Wilms' tumor 1 (Wt1) regulates pleural mesothelial cell plasticity and transition into myofibroblasts in idiopathic pulmonary fibrosis.
24257751 2014 Transcriptional repression of tumor suppressor CDC73, encoding an RNA polymerase II interactor, by Wilms tumor 1 protein (WT1) promotes cell proliferation: implication for cancer therapeutics.
24211094 2013 WT1 isoform expression pattern in acute myeloid leukemia.
24190574 2014 Wilms' tumor gene 1 enhances nutlin-3-induced apoptosis.
24166496 2014 Prohibitin is required for transcriptional repression by the WT1-BASP1 complex.
24161391 2013 Two distinct WT1 mutations identified in patients and relatives with isolated nephrotic proteinuria.
24074521 2014 Prognostic impact of Wilms tumor gene mutations in Egyptian patients with acute myeloid leukemia with normal karyotype.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
23979985 2013 WT1 mutation in pediatric patients with acute myeloid leukemia: a report from the Japanese Childhood AML Cooperative Study Group.
23956224 2014 The prognostic effect of high diagnostic WT1 gene expression in pediatric AML depends on WT1 SNP rs16754 status: report from the Children's Oncology Group.
23945386 2013 WT1 promotes invasion of NSCLC via suppression of CDH1.
23936312 2013 WT1 promotes cell proliferation in non-small cell lung cancer cell lines through up-regulating cyclin D1 and p-pRb in vitro and in vivo.
23898100 2013 Detectable Wilms' tumor-1 transcription at treatment completion is associated with poor prognosis of acute myeloid leukemia: a single institution's experience.
23888944 2014 Transcription factor WT1 and promoter CpG hypomethylation coactivate HOXA10 expression in ovarian cancer.
23874238 2013 Disease-related growth factor and embryonic signaling pathways modulate an enhancer of TCF21 expression at the 6q23.2 coronary heart disease locus.
23871158 2013 Leukemia associated mutant Wilms' tumor gene 1 protein promotes expansion of human hematopoietic progenitor cells.
23832418 2014 The Wilms' tumor suppressor WT1 enhances CD95L expression and promotes activation-induced cell death in leukemic T cells.
23826993 2013 Combinatorial molecular marker assays of WT1, survivin, and TERT at initial diagnosis of adult acute myeloid leukemia.
23791475 2014 Immunolocalization of Wilms' Tumor protein (WT1) in developing human peripheral sympathetic and gastroenteric nervous system.
23715653 2013 A familial WT1 mutation associated with incomplete Denys-Drash syndrome.
23706170 2013 Coordinate patterns of estrogen receptor, progesterone receptor, and Wilms tumor 1 expression in the histopathologic distinction of ovarian from endometrial serous adenocarcinomas.
23699597 2013 WT1 regulates murine hematopoiesis via maintenance of VEGF isoform ratio.
23672350 2013 BAALC and WT1 expressions from diagnosis to hematopoietic stem cell transplantation: consecutive monitoring in adult patients with core-binding-factor-positive AML.
23584566 2013 Bone marrow WT1 levels at diagnosis, post-induction and post-intensification in adult de novo AML.
23554000 2013 A novel WT1 mutation in familial wilms tumor.
23550990 2014 Analysis of WT1 mutations, expression levels and single nucleotide polymorphism rs16754 in de novo non-M3 acute myeloid leukemia.
23550799 2013 Müllerian and eccrine cutaneous ciliated cysts: two different entities? The contribution of WT-1 and PAX8 to diagnosis.
23544132 2013 Wilm's tumor-1 protein levels in urinary exosomes from diabetic patients with or without proteinuria.
23517654 Association of brain-derived neurotrophic factor (BDNF) haploinsufficiency with lower adaptive behaviour and reduced cognitive functioning in WAGR/11p13 deletion syndrome.
23484026 2013 Single nucleotide polymorphisms in the Wilms' tumour gene 1 in clear cell renal cell carcinoma.
23480492 2013 Detection and preliminary characterization of CD8+T lymphocytes specific for Wilms' tumor antigen in patients with non-Hodgkin lymphoma.
23460320 2013 Adoptive transfer of genetically modified Wilms' tumor 1-specific T cells in a novel malignant skull base meningioma model.
23403166 2013 Induction of apoptosis of leukemic cells by TRUE gene silencing using small guide RNAs targeting the WT1 mRNA.
23394625 2013 Prognostic significance of WT1 expression at diagnosis and end of induction in Egyptian adult acute myeloid leukemia patients.
23392705 2013 Interaction of human genes WT1 and CML28 in leukemic cells.
23362234 2013 Role of WT1-ZNF224 interaction in the expression of apoptosis-regulating genes.
23338265 2012 Wilms Tumor 1 protein is not expressed in oral lymphangiomas.
23298185 2013 The Wilms' tumor gene (WT1) regulates E-cadherin expression and migration of prostate cancer cells.
23207289 2013 The significance of Wilms Tumor Gene (WT1) and p53 expression in curettage specimens of patients with endometrial carcinomas.
23142971 2013 Wilms' tumor 1 gene modulates Fas-related death signals and anti-apoptotic functions in hepatocellular carcinoma.
23111196 2012 Reduction in WT1 gene expression during early treatment predicts the outcome in patients with acute myeloid leukemia.
23110703 2013 PRAME and WT1 transcripts constitute a good molecular marker combination for monitoring minimal residual disease in myelodysplastic syndromes.
23110324 2013 Clinical evaluation of WT1 mRNA expression levels in peripheral blood and bone marrow in patients with myelodysplastic syndromes.
23070125 2012 Analysis of SNP rs16754 of WT1 gene in a series of de novo acute myeloid leukemia patients.
23042785 2013 Control of epigenetic states by WT1 via regulation of de novo DNA methyltransferase 3A.
22939983 2012 Repression of transcription by WT1-BASP1 requires the myristoylation of BASP1 and the PIP2-dependent recruitment of histone deacetylase.
22925896 2012 WT1 CpG islands methylation in human lung cancer: a pilot study.
22915059 2012 High WT1 mRNA expression after induction chemotherapy and FLT3-ITD have prognostic impact in pediatric acute myeloid leukemia: a study of the Japanese Childhood AML Cooperative Study Group.
22898820 2012 The transcription factor Wilms tumor 1 confers resistance in myeloid leukemia cells against the proapoptotic therapeutic agent TRAIL (tumor necrosis factor ?-related apoptosis-inducing ligand) by regulating the antiapoptotic protein Bcl-xL.
22895555 2012 Analysis of mutational status, SNP rs16754, and expression levels of Wilms tumor 1 (WT1) gene in acute promyelocytic leukemia.
22876585 2012 A novel WT1 gene mutation in a newborn infant diagnosed with Denys-Drash syndrome.
22875062 2012 Simultaneous analysis of the expression of 14 genes with individual prognostic value in myelodysplastic syndrome patients at diagnosis: WT1 detection in peripheral blood adversely affects survival.
22800892 2012 Identification and analysis of mutations in WTX and WT1 genes in peripheral blood and tumor tissue of children with Wilms' tumor.
22797561 2012 High Wilms' tumor 1 mRNA expression correlates with basal-like and ERBB2 molecular subtypes and poor prognosis of breast cancer.
22796116 2012 Frequency of WT1 and 11p15 constitutional aberrations and phenotypic correlation in childhood Wilms tumour patients.
22688351 2013 Wilms' tumor gene 1: a possible new proangiogenic factor in Hodgkin lymphoma.
22673530 2013 Immunohistochemical expression of Wilms' tumor protein (WT1) in developing human epithelial and mesenchymal tissues.
22672247 2013 Expression of Wilms' tumor 1 (WT1) in oral squamous cell carcinoma.
22623625 2012 Mapping of novel peptides of WT-1 and presenting HLA alleles that induce epitope-specific HLA-restricted T cells with cytotoxic activity against WT-1(+) leukemias.
22585769 2012 Focal segmental glomerulosclerosis in patients with complete deletion of one WT1 allele.
22558480 2012 HIF-1?, VEGF and WT-1 are protagonists in bilateral primary angiosarcoma of breast: a case report and review of literature.
22555024 2012 Expression of four major WT1 splicing variants in acute and chronic myeloid leukemia patients analyzed by newly developed four real-time RT PCRs.
22510877 2012 Human Langerhans cells use an IL-15R-?/IL-15/pSTAT5-dependent mechanism to break T-cell tolerance against the self-differentiation tumor antigen WT1.
22506617 2012 WT1 mutations and single nucleotide polymorphism rs16754 analysis of patients with pediatric acute myeloid leukemia in a Chinese population.
22434317 2012 Desmoplastic small round cell tumor-clinicopathological spectrum, including unusual features and immunohistochemical analysis of 45 tumors diagnosed at a tertiary cancer referral centre, with molecular results t(11; 22) (p13; q12) (EWS-WT1) in select cases.
22415091 2012 Nuclear transport of Wilms' tumour protein Wt1 involves importins ? and ?.
22391154 2012 [Expression of HtrA2 and WT1 genes in acute myeloid leukemia].
22382985 2012 Expression of KRT7 and WT1 differentiates precursor lesions of Wilms' tumours from those of papillary renal cell tumours and mucinous tubular and spindle cell carcinomas.
22313360 2012 Novel report of expression and function of CD97 in malignant gliomas: correlation with Wilms tumor 1 expression and glioma cell invasiveness.
22306650 2012 Common variants at 11p13 are associated with susceptibility to tuberculosis.
22276610 2012 High Wilms' tumour gene (WT1) expression and low mitotic count are independent predictors of survival in diffuse peritoneal mesothelioma.
22261458 2012 Value of PAX8 and WT1 Immunostaining in Confirming the Ovarian Origin of Metastatic Carcinoma in Serous Effusion Specimens.
22246978 2012 Abnormal WT1 expression in human fetuses with bilateral renal agenesis and cardiac malformations.
22242671 2012 Use of (11)C-methionine PET parametric response map for monitoring WT1 immunotherapy response in recurrent malignant glioma.
22238403 2012 Loss of WT1 expression in the endometrium of infertile PCOS patients: a hyperandrogenic effect?
22172722 2011 WT1 mutants reveal SRPK1 to be a downstream angiogenesis target by altering VEGF splicing.
22152856 2011 Expression of Wilms tumor 1 gene in a variety of pediatric tumors.
22148937 2012 Low Wilms' tumor gene expression in tumor tissues predicts poor prognosis in patients with non-small-cell lung cancer.
22093791 2011 [Effects of simvastatin plus all-trans retinoic acid on WT1/hDMP1 gene expression profiles of human promyelocytic leukemia cell line NB4].
22040952 2011 [Silence mechanism of WT1 gene in leukemic cell line U937].
22030397 2011 WT1 protein directly regulates expression of vascular endothelial growth factor and is a mediator of tumor response to hypoxia.
22015946 2012 Single nucleotide polymorphism of Wilms' tumor 1 gene rs16754 in Korean patients with cytogenetically normal acute myeloid leukemia.
21985433 Possible role of WT1 in a human fetus with evolving bronchial atresia, pulmonary malformation and renal agenesis.
21980157 2012 Transcription of nephrin-Neph3 gene pair is synergistically activated by WT1 and NF-?B and silenced by DNA methylation.
21967832 2012 WT1 expression as a marker of minimal residual disease predicts outcome in acute myeloid leukemia when measured post-consolidation.
21942328 2011 WT1 overexpression at diagnosis may predict favorable outcome in patients with de novo non-M3 acute myeloid leukemia.
21909685 2012 Wilms tumor-1, claudin-1 and ezrin are useful immunohistochemical markers that help to distinguish schwannoma from fibroblastic meningioma.
21898091 2012 Wilms' tumor protein 1 (WT1) peptide vaccination in AML patients: predominant TCR CDR3? sequence associated with remission in one patient is detectable in other vaccinated patients.
21896989 WT1 expression as an independent marker of poor prognosis in colorectal cancers.
21888469 2011 Expression of WT1 during normal human kidney development.
21867623 2011 [Detection of WT1 gene in acute myeloid leukemia children by real-time fluorescent quantitative RT-PCR and its clinical significance].
21851196 2011 Clinical pictures and novel mutations of WT1-associated Denys-Drash syndrome in two Chinese children.
21804407 2011 Quantitative assessment of Wilms tumor 1 (WT1) gene transcripts in Egyptian acute lymphoblastic leukemia patients.
21798259 2011 WT1 mutations and polymorphisms in Southeast Asian acute myeloid leukemia.
21760594 2011 Wilms' tumor 1 single-nucleotide polymorphism rs16754 does not predict clinical outcome in adult acute myeloid leukemia.
21734473 2011 Wilms tumor gene 1 (WT1) is a prognostic marker in high-grade uterine sarcoma.
21710692 2011 Frequent promoter hypermethylation of BRCA2, CDH13, MSH6, PAX5, PAX6 and WT1 in ductal carcinoma in situ and invasive breast cancer.
21697701 2011 Wilms tumor 1 expression in vascular neoplasms and vascular malformations.
21673345 2011 Novel adoptive T-cell immunotherapy using a WT1-specific TCR vector encoding silencers for endogenous TCRs shows marked antileukemia reactivity and safety.
21659357 2011 Clinical outcome and gene- and microRNA-expression profiling according to the Wilms tumor 1 (WT1) single nucleotide polymorphism rs16754 in adult de novo cytogenetically normal acute myeloid leukemia: a Cancer and Leukemia Group B study.
21658388 2011 Inhibitory mechanism of pure curcumin on Wilms' tumor 1 (WT1) gene expression through the PKC? signaling pathway in leukemic K562 cells.
21643023 2012 Wilms' tumor gene 1 expression: an independent acute leukemia prognostic indicator following allogeneic hematopoietic SCT.
21607557 2011 Gemcitabine enhances Wilms' tumor gene WT1 expression and sensitizes human pancreatic cancer cells with WT1-specific T-cell-mediated antitumor immune response.
21508141 2011 Analysis of the Wilms' tumor suppressor gene (WT1) in patients 46,XY disorders of sex development.
21504297 2011 Molecular analysis of WT1 and KIT mutations in patients from an Indian population with de novo acute myeloid leukemia: determination of incidence, distribution patterns, and report of a novel KIT mutation.
21499692 2011 Broad and unexpected phenotypic expression in Greek children with steroid-resistant nephrotic syndrome due to mutations in the Wilms' tumor 1 (WT1) gene.
21447831 2011 Specificity for the tumor-associated self-antigen WT1 drives the development of fully functional memory T cells in the absence of vaccination.
21390327 2011 PINCH1 is transcriptional regulator in podocytes that interacts with WT1 and represses podocalyxin expression.
21344764 2010 [Genotyping and minimal residual disease study in children with acute myeloid leukemia: preliminary results].
21269566 2011 Wilms' tumor protein and FLT3-internal tandem duplication expression in patients with de novo acute myeloid leukemia.
21269271 2011 WT1 and its transcriptional cofactor BASP1 redirect the differentiation pathway of an established blood cell line.
21256590 2011 Prevalence and clinical characteristics of N-terminally truncated WT1 expression in acute myeloid leukemia.
21209057 2011 A dual epigenomic approach for the search of obesity biomarkers: DNA methylation in relation to diet-induced weight loss.
21189390 2011 WT1 synonymous single nucleotide polymorphism rs16754 correlates with higher mRNA expression and predicts significantly improved outcome in favorable-risk pediatric acute myeloid leukemia: a report from the children's oncology group.
21189373 2011 WT1 mutation and 11P15 loss of heterozygosity predict relapse in very low-risk wilms tumors treated with surgery alone: a children's oncology group study.
21135860 2011 Monitoring of WT1 expression in PB and CD34(+) donor chimerism of BM predicts early relapse in AML and MDS patients after hematopoietic cell transplantation with reduced-intensity conditioning.
21097671 2011 T-cell immune responses to Wilms tumor 1 protein in myelodysplasia responsive to immunosuppressive therapy.
21057459 2011 WT1 expression in salivary gland pleomorphic adenomas: a reliable marker of the neoplastic myoepithelium.
20974136 2010 Wilms' tumor protein Wt1 regulates the Interleukin-10 (IL-10) gene.
20972333 2010 Wilms tumor 1 (WT1) regulates KRAS-driven oncogenesis and senescence in mouse and human models.
20971509 2011 Erythroid response and decrease of WT1 expression after proteasome inhibition by bortezomib in myelodysplastic syndromes.
20959405 2010 The IFNG (IFN-gamma) genotype predicts cytogenetic and molecular response to imatinib therapy in chronic myeloid leukemia.
20885852 WT1 and kidney progenitor cells.
20880116 2010 ASXL1 mutation is associated with poor prognosis and acute transformation in chronic myelomonocytic leukaemia.
20871039 2010 WT1 expression correlates with angiogenesis in endometrial cancer tissue.
20861915 2010 High frequencies of simultaneous FLT3-ITD, WT1 and KIT mutations in hematological malignancies with NUP98-fusion genes.
20849384 2010 Prognostic potential of detection of WT1 mRNA level in peripheral blood in adult acute myeloid leukemia.
20842112 2010 Wilms' tumour 1 can suppress hTERT gene expression and telomerase activity in clear cell renal cell carcinoma via multiple pathways.
20736771 2010 WT1 immunoprofiling and comparison of malignant Mullerian mixed tumors of the female genital tract.
20678218 2010 Combined mutations of ASXL1, CBL, FLT3, IDH1, IDH2, JAK2, KRAS, NPM1, NRAS, RUNX1, TET2 and WT1 genes in myelodysplastic syndromes and acute myeloid leukemias.
20651072 2010 Heat shock protein 90 regulates the expression of Wilms tumor 1 protein in myeloid leukemias.
20644087 2010 No prognostic impact of the WT1 gene single nucleotide polymorphism rs16754 in pediatric acute myeloid leukemia.
20619457 2010 Structures of native and affinity-enhanced WT1 epitopes bound to HLA-A*0201: implications for WT1-based cancer therapeutics.
20619105 2010 [Effect of RNAi silencing of theWT1 gene on the apoptosis of human hepatocellular carcinoma cell hepG2].
20595692 2010 Genotype/phenotype correlation in nephrotic syndrome caused by WT1 mutations.
20592250 2010 High-frequency type I/II mutational shifts between diagnosis and relapse are associated with outcome in pediatric AML: implications for personalized medicine.
20591825 2010 Biochemical and functional interaction between ZNF224 and ZNF255, two members of the Kruppel-like zinc-finger protein family and WT1 protein isoforms.
20561402 2010 [Biological characteristics of Wt1 gene in relation to Ph(+) leukemia cell line K562].
20507940 2010 Genotype-phenotype correlations in non-Finnish congenital nephrotic syndrome.
20450766 2010 [Alteration of the expression ratio between WT1 gene and its isomers during all-trans retinoic acid-induced differentiation of HL-60 cells].
20442690 2010 WT1 gene mutations in Chinese children with early onset nephrotic syndrome.
20442368 2010 Mutations of the Wilms tumor 1 gene (WT1) in older patients with primary cytogenetically normal acute myeloid leukemia: a Cancer and Leukemia Group B study.
20435628 2010 Prognostic implications of mutations and expression of the Wilms tumor 1 (WT1) gene in adult acute T-lymphoblastic leukemia.
20413658 2010 Prevalence and prognostic implications of WT1 mutations in pediatric acute myeloid leukemia (AML): a report from the Children's Oncology Group.
20412098 Monitoring of minimal residual disease by quantitative WT1 gene expression following reduced intensity conditioning allogeneic stem cell transplantation in acute myeloid leukemia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20376582 2010 Comparison of Wilms' tumor antigen 1-specific T lymphocyte generation soon after nonmyeloablative allergenic stem-cell transplantation in acute and chronic leukemia patients.
20368538 2010 Impact of IDH1 R132 mutations and an IDH1 single nucleotide polymorphism in cytogenetically normal acute myeloid leukemia: SNP rs11554137 is an adverse prognostic factor.
20368469 2010 WT1 mutation in 470 adult patients with acute myeloid leukemia: stability during disease evolution and implication of its incorporation into a survival scoring system.
20332316 2010 Subtype-specific FBXW7 mutation and MYCN copy number gain in Wilms' tumor.
20204298 2010 The Wilms' tumor suppressor WT1 induces estrogen-independent growth and anti-estrogen insensitivity in ER-positive breast cancer MCF7 cells.
20150449 2010 A novel WT1 gene mutation in a three-generation family with progressive isolated focal segmental glomerulosclerosis.
20122399 2010 The Wilms' tumor suppressor protein WT1 is processed by the serine protease HtrA2/Omi.
20092642 2010 Mutation or loss of Wilms' tumor gene 1 (WT1) are not major reasons for immune escape in patients with AML receiving WT1 peptide vaccination.
20038731 2010 Single nucleotide polymorphism in the mutational hotspot of WT1 predicts a favorable outcome in patients with cytogenetically normal acute myeloid leukemia.
20025481 2010 WT-1 expression in gastrointestinal stromal tumours.
20016532 2010 Mutant Wilms' tumor 1 (WT1) mRNA with premature termination codons in acute myeloid leukemia (AML) is sensitive to nonsense-mediated RNA decay (NMD).
20013787 2010 The clinical relevance of Wilms Tumour 1 (WT1) gene mutations in acute leukaemia.
19951528 2009 [The effects of WT1 gene down regulation on the sensitivity of K562/A02 cells to adriamycin].
19856421 2010 Combination of MUC5ac and WT-1 immunohistochemistry is useful in distinguishing pancreatic ductal carcinoma from ovarian serous carcinoma in effusion cytology.
19847202 2010 Wilms tumor 1 (WT1) gene mutations in pediatric T-cell malignancies.
19817904 2009 WT1, p53 and hormone receptor expression in uterine serous carcinoma.
19811333 2009 Wilms' tumor gene 1 expression analysis by real-time quantitative polymerase chain reaction for monitoring of minimal residual disease in acute leukemia.
19776535 2009 WT1 mRNA level in peripheral blood is a sensitive biomarker for monitoring minimal residual disease in acute myeloid leukemia.
19752335 2009 Real-time quantitative polymerase chain reaction detection of minimal residual disease by standardized WT1 assay to enhance risk stratification in acute myeloid leukemia: a European LeukemiaNet study.
19749460 High frequency of loss of allelic integrity at Wilms' tumor suppressor gene-1 locus in advanced breast tumors associated with aggressiveness of the tumor.
19747485 2009 Regulated expression of the alpha isoform of the human thromboxane A2 receptor during megakaryocyte differentiation: a coordinated role for WT1, Egr1, and Sp1.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19638168 2010 WT 1 expression in nevi and melanomas: a marker of melanocytic invasion into the dermis.
19618455 2009 WT1 expression at diagnosis does not predict survival in pediatric AML: a report from the Children's Oncology Group.
19615003 2009 WT1 marker is not sufficient for distinguishing between melanoma and melanocytic nevi.
19605546 2009 Impaired transcription factor interplay in addition to advanced glycation end products suppress podocalyxin expression in high glucose-treated human podocytes.
19578047 2010 High-grade astrocytomas show increased Nestin and Wilms's tumor gene (WT1) protein expression.
19549856 2009 An integrated genome screen identifies the Wnt signaling pathway as a major target of WT1.
19536888 2009 Wilms tumor 1 gene mutations are associated with a higher risk of recurrence in young adults with acute myeloid leukemia: a study from the Acute Leukemia French Association.
19494353 2009 WT1 mutations in T-ALL.
19443388 2009 Immunohistochemical detection of WT1 protein in endometrial cancer.
19437143 2009 No evidence for WT1 involvement in a beta-catenin-independent activation of the Wnt signaling pathway in pituitary adenomas.
19416806 2009 The tumor suppressor WTX shuttles to the nucleus and modulates WT1 activity.
19407365 2009 Dual usages of single Wilms' tumor 1 immunohistochemistry in evaluation of breast tumors: a preliminary study of 30 cases.
19404640 2009 Wilms' tumor gene 1 (WT1) expression in subtypes of acute lymphoblastic leukemia (ALL) of adults and impact on clinical outcome.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
19322206 2009 Standardization of WT1 mRNA quantitation for minimal residual disease monitoring in childhood AML and implications of WT1 gene mutations: a European multicenter study.
19321755 2009 Inhibition of epidermal growth factor receptor (EGFR) expression by human cytomegalovirus correlates with an increase in the expression and binding of Wilms' Tumour 1 protein to the EGFR promoter.
19250757 2009 Expression of Wilms tumor-1 protein and CD 138 in malignant mesothelioma of the tunica vaginalis.
19236519 2009 Wilms' tumour gene 1 (WT1) positivity in endothelial cells surrounding epithelial uterine tumours.
19221039 2009 Prognostic impact of WT1 mutations in cytogenetically normal acute myeloid leukemia: a study of the German-Austrian AML Study Group.
19212333 2009 GATA-1 and GATA-2 binding to 3' enhancer of WT1 gene is essential for its transcription in acute leukemia and solid tumor cell lines.
19205749 2009 Membranoproliferative glomerulonephritis associated with a mutation in Wilms' tumour suppressor gene 1.
19190340 2009 Wilms' tumor 1 gene expression in hepatocellular carcinoma promotes cell dedifferentiation and resistance to chemotherapy.
19171881 2009 Clinical relevance of Wilms tumor 1 gene mutations in childhood acute myeloid leukemia.
19169475 2008 Clinical and genetic findings of five patients with WT1-related disorders.
19141860 2009 Genetic variants in the candidate genes of the apoptosis pathway and susceptibility to chronic myeloid leukemia.
19137020 2009 Canonical WNT signalling determines lineage specificity in Wilms tumour.
19123921 2009 Contribution of individual amino acids to the RNA binding activity of the Wilms' tumor suppressor protein WT1.
19120973 2008 A WT1 protein-derived, naturally processed 16-mer peptide, WT1(332), is a promiscuous helper peptide for induction of WT1-specific Th1-type CD4(+) T cells.
19099861 2008 [Clinical characteristics and WT1 genetic analysis of patients with steroid-resistant nephrotic syndrome accompanied with genitourinary malformations].
19097357 2008 Examination of expression of WT1 gene product and CD44 adhesive molecule in nephroblastoma histologic types.
19067769 The Wilms' tumour suppressor protein WT1 acts as a key transcriptional repressor of the human thromboxane A2 receptor gene in megakaryocytes.
19050011 2009 Dynamic interaction between WT1 and BASP1 in transcriptional regulation during differentiation.
19017365 WT1 represses HOX gene expression in the regulation of gynaecologic tumour histologic type.
18972317 2009 Expression of the multidrug resistance protein MRP and the lung-resistance protein LRP in nasal NK/T cell lymphoma: further exploring the role of P53 and WT1 gene.
18950857 2009 Expression patterns of WT1 and PRAME in acute myeloid leukemia patients and their usefulness for monitoring minimal residual disease.
18929401 2008 Wilms' tumor gene 1 (WT1) in endometrial carcinoma.
18801058 2009 Quantitative assessment of WT1 gene expression after allogeneic stem cell transplantation is a useful tool for monitoring minimal residual disease in acute myeloid leukemia.
18756326 2008 The ratio of +/-KTS splice variants of the Wilms' tumour suppressor protein WT1 mRNA is determined by an intronic enhancer.
18752126 2008 WT1 expression in endometrioid ovarian carcinoma with and without associated endometriosis.
18751389 The Wilms' tumor suppressor WT1 inhibits malignant progression of neoplastigenic mammary epithelial cells.
18722603 2009 Wilms' tumor gene 1 (WT1) overexpression in neurons in deep endometriosis: a pilot study.
18708366 2008 Wilms' tumor 1 suppressor gene mediates antiestrogen resistance via down-regulation of estrogen receptor-alpha expression in breast cancer cells.
18703217 2008 A new molecular variant of desmoplastic small round cell tumor: significance of WT1 immunostaining in this entity.
18688870 2008 Vertical transmission of a mutation in exon 1 of the WT1 gene: lessons for genetic counseling.
18666806 PAX3 is expressed in the stromal compartment of the developing kidney and in Wilms tumors with myogenic phenotype.
18644985 2008 WT1 induction of mitogen-activated protein kinase phosphatase 3 represents a novel mechanism of growth suppression.
18618575 2008 Clinical relevance of mutations in the Wilms tumor suppressor 1 gene WT1 and the cadherin-associated protein beta1 gene CTNNB1 for patients with Wilms tumors: results of long-term surveillance of 71 patients from International Society of Pediatric Oncology Study 9/Society for Pediatric Oncology.
18604725 2008 Expression profile of orphan receptor tyrosine kinase (ROR1) and Wilms' tumor gene 1 (WT1) in different subsets of B-cell acute lymphoblastic leukemia.
18591546 2008 Mutation of the Wilms' tumor 1 gene is a poor prognostic factor associated with chemotherapy resistance in normal karyotype acute myeloid leukemia: the United Kingdom Medical Research Council Adult Leukaemia Working Party.
18590714 2008 Minimal residual disease detection in acute myeloid leukemia by mutant nucleophosmin (NPM1): comparison with WT1 gene expression.
18559874 2008 Wilms' tumor 1 gene mutations independently predict poor outcome in adults with cytogenetically normal acute myeloid leukemia: a cancer and leukemia group B study.
18528287 2008 Cytoplasmic overexpression of WT-1 in gastrointestinal stromal tumor and other soft tissue tumors.
18516627 2008 A novel Wilms' tumor 1 gene mutation in a child with severe renal dysfunction and persistent renal blastema.
18469795 2008 WT1 immunoreactivity in breast carcinoma: selective expression in pure and mixed mucinous subtypes.
18466223 2009 Diagnostic value of WT1 in neuroepithelial tumours.
18464243 2008 Duplication of paternal IGF2 or loss of maternal IGF2 imprinting occurs in half of Wilms tumors with various structural WT1 abnormalities.
18443273 2008 Early prediction of treatment outcome in acute myeloid leukemia by measurement of WT1 transcript levels in peripheral blood samples collected after chemotherapy.
18425046 2008 Expression of CD56 and WT1 in ovarian stroma and ovarian stromal tumors.
18424770 2008 The Wilms' tumor suppressor Wt1 activates transcription of the erythropoietin receptor in hematopoietic progenitor cells.
18385267 2008 New insights into the function of the Wilms tumor suppressor gene WT1 in podocytes.
18371184 2008 WT1 expression distinguishes astrocytic tumor cells from normal and reactive astrocytes.
18311776 2008 Wilms tumor genetics: mutations in WT1, WTX, and CTNNB1 account for only about one-third of tumors.
18292948 2008 Wilms' tumor gene WT1-shRNA as a potent apoptosis-inducing agent for solid tumors.
18273617 2008 Topotecan distribution in an anephric infant with therapy-resistant bilateral Wilms tumor with a novel germline WT1 gene mutation.
18271004 2008 Characteristics of testicular dysgenesis syndrome and decreased expression of SRY and SOX9 in Frasier syndrome.
18260155 2008 Wilms tumor gene protein 1 is associated with ovarian cancer metastasis and modulates cell invasion.
18255279 2008 Wilms' tumour 1 gene expression is increased in hepatocellular carcinoma and associated with poor prognosis.
18231915 2008 Cross-sectional monitoring of Wilms' tumor gene 1 (WT1) expression in Iranian patients with acute lymphoblastic leukemia at diagnosis, relapse and remission.
18231640 2008 A pathologic link between Wilms tumor suppressor gene, WT1, and IFI16.
18212735 2008 The Wilms' tumour suppressor WT1 is involved in endothelial cell proliferation and migration: expression in tumour vessels in vivo.
18202757 2008 Expression of the WT1 gene -KTS domain isoforms suppresses the invasive ability of human lung squamous cell carcinoma cells.
18181329 2007 Growth inhibition of breast cancer cell line MCF-7 by siRNA silencing of Wilms tumor 1 gene.
18094593 2007 [Clinical significance of quantitation of WT1 gene expression for minimal residual disease monitoring of acute myelogenous leukemia].
18081724 2008 Wilms tumour gene 1 overexpression in bone marrow as a marker for minimal residual disease in acute myeloid leukaemia.
18065803 2008 Mutations in PLCE1 are a major cause of isolated diffuse mesangial sclerosis (IDMS).
18064689 2008 Utility of WT-1, p63, MOC31, mesothelin, and cytokeratin (K903 and CK5/6) immunostains in differentiating adenocarcinoma, squamous cell carcinoma, and malignant mesothelioma in effusions.
18064385 2007 Reversible histone acetylation involved in transcriptional regulation of WT1 gene.
18058136 2008 Eye involvement in children with primary focal segmental glomerulosclerosis.
18042071 2007 The expression of Wilms' tumour-1 and Ca125 in invasive micropapillary carcinoma of the breast.
18034345 2008 Effect of pure curcumin, demethoxycurcumin, and bisdemethoxycurcumin on WT1 gene expression in leukemic cell lines.
17972942 2008 The hDMP1 tumor suppressor is a new WT1 target in myeloid leukemias.
17956689 2007 [Transcriptional activity of WT1 gene promoter and enhancer in diverse cell lines].
17947653 2007 Targeting the Wilms tumor antigen 1 by TCR gene transfer: TCR variants improve tetramer binding but not the function of gene modified human T cells.
17940140 2007 Alternately spliced WT1 antisense transcripts interact with WT1 sense RNA and show epigenetic and splicing defects in cancer.
17939399 2007 [Expression of WT1 gene and its isomer ratio changes during phorbol ester induced differentiation of K562 cell line].
17934764 2008 WT1 and NPHS2 mutations in Korean children with steroid-resistant nephrotic syndrome.
17912546 2008 The Wilms' tumor suppressor WT1 is associated with melanoma proliferation.
17886559 2007 Wilms tumor 1 expression in malignant gliomas and correlation of +KTS isoforms with p53 status.
17869219 2007 Human lymphocytes express the transcriptional regulator, Wilms tumor 1: the role of WT1 in mediating nitric oxide-dependent repression of lymphocyte proliferation.
17853480 2007 WT1 mutations in Meacham syndrome suggest a coelomic mesothelial origin of the cardiac and diaphragmatic malformations.
17848411 2007 Developmental changes in human fetal testicular cell numbers and messenger ribonucleic acid levels during the second trimester.
17803653 2007 Wilms' tumor 1 message and protein expression in bone marrow failure syndrome and acute leukemia.
17728783 2007 Deregulation of the Wilms' tumour gene 1 protein (WT1) by BCR/ABL1 mediates resistance to imatinib in human leukaemia cells.
17721194 2007 Diagnostic utility of WT1 immunostaining in ovarian sertoli cell tumor.
17716689 2007 Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA.
17706117 2007 [Promoter methylation and mRNA expression of WT1 gene in MCF10 breast cancer model].
17688410 2007 The Wilms' tumor gene 1 (WT1) induces expression of the N-myc downstream regulated gene 2 (NDRG2).
17665418 2007 Characterization of the insulin-like growth factor axis and Wilms' tumour suppressor gene in hyperparathyroidism.
17630404 2007 Raised risk of Wilms tumour in patients with aniridia and submicroscopic WT1 deletion.
17605875 2007 [WT1 gene expression and its isoform ratio in different cell subsets of normal human bone marrow].
17599043 2008 Wilms' tumor protein 1: an early target of progestin regulation in T-47D breast cancer cells that modulates proliferation and differentiation.
17579045 2007 The transcription factor Wilms tumor 1 regulates matrix metalloproteinase-9 through a nitric oxide-mediated pathway.
17551084 2007 Different CTNNB1 mutations as molecular genetic proof for the independent origin of four Wilms tumours in a patient with a novel germ line WT1 mutation.
17541636 2008 WT1 gene mutations in three girls with nephrotic syndrome.
17540436 2007 Expression level of Wilms tumor 1 (WT1) protein has limited prognostic value in epithelial ovarian cancer: from the Danish "MALOVA" ovarian cancer study.
17531467 2007 Upregulation of Wilms' tumour gene 1 (WT1) in uterine sarcomas.
17524167 2007 The role of the Wilms tumour gene (WT1) in normal and malignant haematopoiesis.
17508006 2007 WT1 transcript amount discriminates secondary or reactive eosinophilia from idiopathic hypereosinophilic syndrome or chronic eosinophilic leukemia.
17496156 2007 Coexpression of Wilms' tumor suppressor 1 (WT1) and androgen receptor (AR) in the genital tract of human male embryos and regulation of AR promoter activity by WT1.
17487399 2007 VEGF transcription and mRNA stability are altered by WT1 not DDS(R384W) expression in LNCaP cells.
17371932 2007 Nephrotic syndrome in the first year of life: two thirds of cases are caused by mutations in 4 genes (NPHS1, NPHS2, WT1, and LAMB2).
17361230 2007 A tumor suppressor and oncogene: the WT1 story.
17216259 2007 Mutational analysis of NPHS2 and WT1 in frequently relapsing and steroid-dependent nephrotic syndrome.
17210670 2007 A CTCF-binding silencer regulates the imprinted genes AWT1 and WT1-AS and exhibits sequential epigenetic defects during Wilms' tumourigenesis.
17206472 2007 Down-regulation of Wilms' tumor 1 expression in glioblastoma cells increases radiosensitivity independently of p53.
17205055 2007 Wilms' tumour 1 mutations are associated with FLT3-ITD and failure of standard induction chemotherapy in patients with normal karyotype AML.
17160023 2007 Isoforms of Wilms' tumor suppressor gene (WT1) have distinct effects on mammary epithelial cells.
16990584 2007 Molecular profiling of CD34+ cells in idiopathic myelofibrosis identifies a set of disease-associated genes and reveals the clinical significance of Wilms' tumor gene 1 (WT1).
16987884 2006 The many facets of the Wilms' tumour gene, WT1.
16966277 2006 Down-regulation of wt1 expression in leukemia cell lines as part of apoptotic effect in arsenic treatment using two compounds.
16934801 2006 WT1 interacts with the splicing protein RBM4 and regulates its ability to modulate alternative splicing in vivo.
16927106 2006 WT1 and glomerular diseases.
16924231 2007 hnRNP-U directly interacts with WT1 and modulates WT1 transcriptional activation.
16920711 2006 The Wilms tumor suppressor Wt1 promotes cell adhesion through transcriptional activation of the alpha4integrin gene.
16909243 2006 WT1 mutations in nephrotic syndrome revisited. High prevalence in young girls, associations and renal phenotypes.
16883592 2007 Prognostic significance of WT1 gene expression in pediatric acute myeloid leukemia.
16876863 2007 Quantitative assessment of WT1 expression in diagnosis of childhood acute leukemia.
16857797 2006 High WT1 expression is associated with very poor survival of patients with osteogenic sarcoma metastasis.
16828156 2007 In vitro leukemic cell differentiation and WT1 gene expression.
16780544 2006 Posttransplant recurrence of proteinuria in a case of focal segmental glomerulosclerosis associated with WT1 mutation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16518414 2006 Antiapoptotic function of 17AA(+)WT1 (Wilms' tumor gene) isoforms on the intrinsic apoptosis pathway.
16502587 2006 WT1 overexpression in acute myeloid leukemia and myelodysplastic syndromes.
16467207 2006 Wilms tumor suppressor, Wt1, is a transcriptional activator of the erythropoietin gene.
16087727 2005 The WT1 Wilms' tumor suppressor gene product interacts with estrogen receptor-alpha and regulates IGF-I receptor gene transcription in breast cancer cells.
15982325 2005 WT1 expression in angiogenic tumours of the skin.
15961562 2005 Expression, regulation, and function of paired-box gene 8 in the human placenta and placental cancer cell lines.
15957141 2005 Novel familial WT1 read-through mutation associated with Wilms tumor and slow progressive nephropathy.
15927676 2005 Wt1 is not essential for hematopoiesis in the mouse.
15894924 2005 Differential expression of WT1 gene product in non-Hodgkin lymphomas.
15878620 2005 Aberrant expression of tumor suppressor genes and their association with chimeric oncogenes in pediatric acute lymphoblastic leukemia.
15845894 2005 Direct recognition and lysis of leukemia cells by WT1-specific CD4+ T lymphocytes in an HLA class II-restricted manner.
15838390 2005 WT1 gene analysis in sporadic early-onset and bilateral wilms tumor patients without associated abnormalities.
15780077 2005 Analysis of NPHS1, NPHS2, ACTN4, and WT1 in Japanese patients with congenital nephrotic syndrome.
15696971 2004 Expression of the Wilms' tumor gene product WT1 in glioblastomas and medulloblastomas.
15687485 2005 Variants in the Wilms' tumor gene are associated with focal segmental glomerulosclerosis in the African American population.
15674342 2005 HER2/neu increases the expression of Wilms' Tumor 1 (WT1) protein to stimulate S-phase proliferation and inhibit apoptosis in breast cancer cells.
15661271 2005 Quantitative RT-PCR of Wilms tumor gene transcripts (WT1) for the molecular monitoring of patients with accelerated phase bcr/abl + CML.
15540161 2005 Upregulation of Wilms' tumor gene 1 (WT1) in desmoid tumors.
15538407 2005 Th1-biased humoral immune responses against Wilms tumor gene WT1 product in the patients with hematopoietic malignancies.
15534117 2004 Myeloma cells are highly sensitive to the granule exocytosis pathway mediated by WT1-specific cytotoxic T lymphocytes.
15520190 2004 SUMO-1 modification of the Wilms' tumor suppressor WT1.
15518539 2004 Why zinc fingers prefer zinc: ligand-field symmetry and the hidden thermodynamics of metal ion selectivity.
15510596 Overexpression of the Wilms' tumor gene WT1 in esophageal cancer.
15506928 2004 Transcriptional regulation by the Wilms' tumour suppressor protein WT1.
15504938 2004 WT1 activates a glomerular-specific enhancer identified from the human nephrin gene.
15504250 2004 Overexpression of the Wilms' tumor gene W T1 in primary astrocytic tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15483024 2004 Frequency and heritability of WT1 mutations in nonsyndromic Wilms' tumor patients: a UK Children's Cancer Study Group Study.
15365188 2004 Induction of WT1 (Wilms' tumor gene)-specific cytotoxic T lymphocytes by WT1 peptide vaccine and the resultant cancer regression.
15349765 2004 A novel mutation of WT1 exon 9 in a patient with Denys-Drash syndrome and pyloric stenosis.
15339675 2004 Prognostic implications of Wilms' tumor gene (WT1) expression in patients with de novo acute myeloid leukemia.
15297187 2004 Wilms Tumor Gene (WT1) and p53 expression in endometrial carcinomas: a study of 130 cases using a tissue microarray.
15286719 2004 Transcriptional activation of c-myc proto-oncogene by WT1 protein.
15266301 2004 Mutation analysis of five candidate genes in Chinese patients with hypospadias.
15253707 2004 Prevalence of WT1 mutations in a large cohort of patients with steroid-resistant and steroid-sensitive nephrotic syndrome.
15223639 2004 Multiplex real-time RT-PCR for prospective evaluation of WT1 and fusion gene transcripts in newly diagnosed de novo acute myeloid leukemia.
15150775 2004 Twenty-four new cases of WT1 germline mutations and review of the literature: genotype/phenotype correlations for Wilms tumor development.
15084838 2004 WT1 is differentially expressed in serous, endometrioid, clear cell, and mucinous carcinomas of the peritoneum, fallopian tube, ovary, and endometrium.
14988155 2004 Use of B cell-bound HLA-A2 class I monomers to generate high-avidity, allo-restricted CTLs against the leukemia-associated protein Wilms tumor antigen.
14988020 2004 Activation of the WT1 tumor suppressor gene promoter by Pea3.
14962262 2004 Significant co-expression of WT1 and MDR1 genes in acute myeloid leukemia patients at diagnosis.
14767530 2004 Suppression of prostate tumor cell growth in vivo by WT1, the Wilms' tumor suppressor gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701728 2004 BASP1 is a transcriptional cosuppressor for the Wilms' tumor suppressor protein WT1.
14681303 2004 Genomic imprinting at the WT1 gene involves a novel coding transcript (AWT1) that shows deregulation in Wilms' tumours.
14666652 Inhibition of breast cancer cell growth by the Wilms' tumor suppressor WT1 is associated with a destabilization of beta-catenin.
12970737 2003 Transcriptional activity of testis-determining factor SRY is modulated by the Wilms' tumor 1 gene product, WT1.
12961083 2003 Expression of nephrin, podocin, alpha-actinin, and WT1 in children with nephrotic syndrome.
12960088 2003 The WT1 Wilms' tumor suppressor gene: a novel target for insulin-like growth factor-I action.
12914969 2003 Wilms' tumor suppressor (WT1) is a mediator of neuronal degeneration associated with the pathogenesis of Alzheimer's disease.
12901797 2003 Overexpression of the Wilms' tumor gene WT1 in colorectal adenocarcinoma.
12841869 2003 Overexpression of the Wilms' tumor gene WT1 in primary thyroid cancer.
12841384 2003 The lck promoter-driven expression of the Wilms tumor gene WT1 blocks intrathymic differentiation of T-lineage cells.
12829997 2003 Expression of Wilms' tumor suppressor in the liver with cirrhosis: relation to hepatocyte nuclear factor 4 and hepatocellular function.
12824921 2003 Overexpression of the Wilms' tumor gene WT1 in human bone and soft-tissue sarcomas.
12824878 2003 Overexpression of the Wilms' tumor gene WT1 in head and neck squamous cell carcinoma.
12802290 2003 Upregulation of c-MYC in WT1-mutant tumors: assessment of WT1 putative transcriptional targets using cDNA microarray expression profiling of genetically defined Wilms' tumors.
12761165 2003 Significant reduction of WT1 gene expression, possibly due to epigenetic alteration in Wilms' tumor.
12681485 2003 Regulation of taurine transporter gene (TauT) by WT1.
12665546 2003 The complex life of WT1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471221 2002 Correlation between a specific Wilms tumour suppressor gene (WT1) mutation and the histological findings in Wilms tumour (WT).
12444079 2003 WT1-p53 interactions in insulin-like growth factor-I receptor gene regulation.
12411326 2002 Two distinct HLA-A0201-presented epitopes of the Wilms tumor antigen 1 can function as targets for leukemia-reactive CTL.
12239212 2002 Inhibition of Wilms tumor 1 transactivation by bone marrow zinc finger 2, a novel transcriptional repressor.
12213901 2002 WT1 and DAX-1 inhibit aromatase P450 expression in human endometrial and endometriotic stromal cells.
12200377 2002 CD8 T-cell responses to Wilms tumor gene product WT1 and proteinase 3 in patients with acute myeloid leukemia.
12199781 2002 Abnormal WT1 expression in the CD34-negative compartment in myelodysplastic bone marrow.
12161615 2002 A necropsy case of Denys-Drash syndrome with a WT1 mutation in exon 7.
12133898 2002 The Wilms' tumor suppressor Wt1 is associated with the differentiation of retinoblastoma cells.
12127961 2002 Downregulation of Wilms' tumor 1 protein inhibits breast cancer proliferation.
12111123 2002 Immunogenicity of WT-1 peptides.
12070003 2002 HLA class II haplotype and quantitation of WT1 RNA in Japanese patients with paroxysmal nocturnal hemoglobinuria.
11986946 2002 The coexpression of the apoptosis-related genes bcl-2 and wt1 in predicting survival in adult acute myeloid leukemia.
11960373 2002 Induction of the interleukin-2/15 receptor beta-chain by the EWS-WT1 translocation product.
11933209 2002 A review of the phenotypic variation due to the Denys-Drash syndrome-associated germline WT1 mutation R362X.
11919196 2002 Cyclin E is a target of WT1 transcriptional repression.
11912180 2002 WT1 is a key regulator of podocyte function: reduced expression levels cause crescentic glomerulonephritis and mesangial sclerosis.
11889045 2002 The Wilms' tumor gene Wt1 is required for normal development of the retina.
11738793 2001 Clinical and molecular evidence for the role of androgens and WT1 in testis descent.
11595161 2001 WT1 proteins: functions in growth and differentiation.
11519891 2001 Novel WT1 mutation (C388Y) in a female child with Denys-Drash syndrome.
11237525 2001 Wilms tumor and the WT1 gene.
11182928 2000 Constitutional WT1 correlate with clinical features in children with progressive nephropathy.
11001926 2000 Identification of WTAP, a novel Wilms' tumour 1-associating protein.
10838070 2000 Modulation of EWS/WT1 activity by the v-Src protein tyrosine kinase.
10799199 2000 A novel missense mutation of the Wt1 gene causing Denys-Drash syndrome with exceptionally mild renal manifestations.
10738002 2000 Novel WT1 exon 9 mutation (D396Y) in a patient with early onset Denys Drash syndrome.
10571943 1999 Exon 9 mutations in the WT1 gene, without influencing KTS splice isoforms, are also responsible for Frasier syndrome.
10101119 1999 YAC complementation shows a requirement for Wt1 in the development of epicardium, adrenal gland and throughout nephrogenesis.
9815658 1997 The Wilms' tumor gene WT1 can regulate genes involved in sex determination and differentiation: SRY, Müllerian-inhibiting substance, and the androgen receptor.
9784496 1998 WT1 interacts with the splicing factor U2AF65 in an isoform-dependent manner and can be incorporated into spliceosomes.
9765217 1998 Induction of Rb-associated protein (RbAp46) by Wilms' tumor suppressor WT1 mediates growth inhibition.
9607189 1998 Spectrum of early onset nephrotic syndrome associated with WT1 missense mutations.
9553041 1998 Inhibition of cellular proliferation by the Wilms tumor suppressor WT1 requires association with the inducible chaperone Hsp70.
9529364 1998 Identification of constitutional WT1 mutations, in patients with isolated diffuse mesangial sclerosis, and analysis of genotype/phenotype correlations by use of a computerized mutation database.
9475094 1998 Do intronic mutations affecting splicing of WT1 exon 9 cause Frasier syndrome?
9366517 1997 Inhibition of the DNA-binding and transcriptional repression activity of the Wilms' tumor gene product, WT1, by cAMP-dependent protein kinase-mediated phosphorylation of Ser-365 and Ser-393 in the zinc finger domain.
9361029 1997 Paternal expression of WT1 in human fibroblasts and lymphocytes.
9178767 1997 Differential regulation of the human Wilms tumour suppressor gene (WT1) promoter by two isoforms of PAX2.
9108089 1997 Correlation of germ-line mutations and two-hit inactivation of the WT1 gene with Wilms tumors of stromal-predominant histology.
9006935 1997 Sp1 is a critical regulator of the Wilms' tumor-1 gene.
8956030 A novel mutation H373Y in the Wilms' tumor suppressor gene, WT1, associated with Denys-Drash syndrome.
8741319 1996 A newly identified exonic mutation of the WT1 gene in a patient with Denys-Drash syndrome.
8621495 1996 A non-AUG translational initiation event generates novel WT1 isoforms.
8414514 1993 Characterization of the transcriptional regulatory region of the human WT1 gene.
8411073 1993 Mutational screening of the Wilms's tumour gene, WT1, in males with genital abnormalities.
8401592 1993 The Wilms tumour gene WT1 is expressed in murine mesoderm-derived tissues and mutated in a human mesothelioma.
8393820 1993 The WT1 Wilms tumor gene product: a developmentally regulated transcription factor in the kidney that functions as a tumor suppressor.
8389468 1993 Physical and functional interaction between WT1 and p53 proteins.
8388765 1993 Evidence that WT1 mutations in Denys-Drash syndrome patients may act in a dominant-negative fashion.
8306891 1993 Nuclear localization of the protein encoded by the Wilms' tumor gene WT1 in embryonic and adult tissues.
8295405 1993 Molecular analysis of two Japanese cases of Denys-Drash syndrome.
8290269 1994 Antisense transcripts and protein binding motifs within the Wilms tumour (WT1) locus.
8132626 1994 Transcriptional regulation of the human Wilms' tumor gene (WT1). Cell type-specific enhancer and promiscuous promoter.
8119964 1994 The Wilms' tumor suppressor gene WT1 is negatively autoregulated.
8112732 1994 WT1 mutations in patients with Denys-Drash syndrome: a novel mutation in exon 8 and paternal allele origin.
8111391 1993 A novel zinc finger mutation in a patient with Denys-Drash syndrome.
8098976 1993 A novel insertional mutation at the third zinc finger coding region of the WT1 gene in Denys-Drash syndrome.
8086342 1994 Wilms' tumor gene, WT1, mRNA is down-regulated during induction of erythroid and megakaryocytic differentiation of K562 cells.
8012395 1994 Mosaic and polymorphic imprinting of the WT1 gene in humans.
7926762 1994 RNA editing in the Wilms' tumor susceptibility gene, WT1.
7862627 1995 Characterization of the genomic breakpoint and chimeric transcripts in the EWS-WT1 gene fusion of desmoplastic small round cell tumor.
7862533 1995 High affinity binding sites for the Wilms' tumour suppressor protein WT1.
7856737 1995 Comparative in situ hybridization analysis of PAX2, PAX8, and WT1 gene transcription in human fetal kidney and Wilms' tumors.
7731725 1995 Exclusion of the Wilms tumour gene (WT1) promoter as a site of frequent mutation in Wilms tumour.
7720589 1995 Repression of Pax-2 by WT1 during normal kidney development.
7588596 1995 WT1 suppresses synthesis of the epidermal growth factor receptor and induces apoptosis.
7585606 1995 Regulation of the proto-oncogenes bcl-2 and c-myc by the Wilms' tumor suppressor gene WT1.
6088386 1984 High-resolution studies in patients with aniridia-Wilms tumor association, Wilms tumor or related congenital abnormalities.
2173145 1990 Tissue, developmental, and tumor-specific expression of divergent transcripts in Wilms tumor.
2154702 1990 Homozygous deletion in Wilms tumours of a zinc-finger gene identified by chromosome jumping.
2154335 1990 Isolation and characterization of a zinc finger polypeptide gene at the human chromosome 11 Wilms' tumor locus.
1671709 1991 Isolation, characterization, and expression of the murine Wilms' tumor gene (WT1) during kidney development.
1662794 1991 Characterization of the zinc finger protein encoded by the WT1 Wilms' tumor locus.
1658787 1991 Alternative splicing and genomic structure of the Wilms tumor gene WT1.
1655284 1991 Germline mutations in the Wilms' tumor suppressor gene are associated with abnormal urogenital development in Denys-Drash syndrome.
1654525 1991 WT1 mutations contribute to abnormal genital system development and hereditary Wilms' tumour.
1572653 1992 The genomic organization and expression of the WT1 gene.
1338906 1992 Constitutional mutations in the WT1 gene in patients with Denys-Drash syndrome.
1332065 1992 Human platelet-derived growth factor A chain is transcriptionally repressed by the Wilms tumor suppressor WT1.
1317572 1992 Zinc finger point mutations within the WT1 gene in Wilms tumor patients.
1313285 1992 WT1: a novel tumor suppressor gene inactivated in Wilms' tumor.
1302008 1992 Germline intronic and exonic mutations in the Wilms' tumour gene (WT1) affecting urogenital development.