Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.600 1.7e-03
astrocytoma -1.100 7.7e-22
Astrocytoma, Pilocytic -2.200 9.4e-07
atypical teratoid / rhabdoid tumor -1.600 5.3e-03
ependymoma -1.400 1.6e-04
glioblastoma -2.200 5.4e-07
group 3 medulloblastoma -2.200 4.4e-03
interstitial cystitis -1.300 6.4e-05
medulloblastoma, large-cell -1.700 1.3e-02
osteosarcoma 1.322 7.3e-05
ovarian cancer 1.100 8.8e-10
pituitary cancer 1.200 1.5e-03
primitive neuroectodermal tumor -2.200 7.8e-04
subependymal giant cell astrocytoma -3.370 3.1e-03

Gene RIF (2)

AA Sequence

MAKLWFKFQRYFRRKPVRFFTFLALYLTAGSLVFLHSGFVGQPAVSGNQANPAAAGGPAEGAELSFLGDM      1 - 70
HLGRGFRDTGEASSIARRYGPWFKGKDGNERAKLGDYGGAWSRALKGRVVREKEEERAKYIGCYLDDTQS     71 - 140
RALRGVSFFDYKKMTIFRCQDNCAERGYLYGGLEFGAECYCGHKIQATNVSEAECDMECKGERGSVCGGA    141 - 210
NRLSVYRLQLAQESARRYGSAVFRGCFRRPDNLSLALPVTAAMLNMSVDKCVDFCTEKEYPLAALAGTAC    211 - 280
HCGFPTTRFPLHDREDEQLCAQKCSAEEFESCGTPSYFIVYQTQVQDNRCMDRRFLPGKSKQLIALASFP    281 - 350
GAGNTWARHLIELATGFYTGSYYFDGSLYNKGFKGERDHWRSGRTICIKTHESGQKEIEAFDAAILLIRN    351 - 420
PYKALMAEFNRKYGGHIGFAAHAHWKGKEWPEFVRNYAPWWATHTLDWLKFGKKVLVVHFEDLKQDLFVQ    421 - 490
LGRMVSLLGVAVREDRLLCVESQKDGNFKRSGLRKLEYDPYTADMQKTISAYIKMVDAALKGRNLTGVPD    491 - 560
DYYPR                                                                     561 - 565
//

Text Mined References (9)

PMID Year Title