Property Summary

NCBI Gene PubMed Count 10
PubMed Score 12.20
PubTator Score 10.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
chronic lymphocytic leukemia 2.069 3.0e-04
posterior fossa group A ependymoma -1.200 1.6e-07
astrocytoma -1.300 4.2e-03
atypical teratoid / rhabdoid tumor -1.600 1.2e-07
glioblastoma -1.200 6.6e-06
medulloblastoma, large-cell -2.800 6.0e-04
intraductal papillary-mucinous neoplasm ... 1.200 1.3e-02
adult high grade glioma -1.100 4.0e-03
inflammatory breast cancer 1.300 1.9e-06
lung carcinoma 1.600 2.7e-27
ovarian cancer 2.400 4.8e-05

Synonym

Accession Q9NYS7 B4DIE6 B4DPV6 Q9NRX9 WSB-2
Symbols SBA2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
22082156 Knockdown of WD repeat and SOCS box containing 2 (WSB2) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20059963 This report provides the first evidence that WSB-2 is a regulator of IL-21R expression and IL-21-induced signal transduction.
11819827 SBA2 gene might be a promising novel biomarker of cell differentiation in colorectal cancer and its biological features need further studies.

AA Sequence

MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKS      1 - 70
RSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWPSPPSRKLWARHHPQVPDVSCLVLATGLNDGQIKIWEV     71 - 140
QTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQVLSGHLQWVYCCSISPDCS    141 - 210
MLCSAAGEKSVFLWSMRSYTLIRKLEGHQSSVVSCDFSPDSALLVTASYDTNVIMWDPYTGERLRSLHHT    211 - 280
QVDPAMDDSDVHISSLRSVCFSPEGLYLATVADDRLLRIWALELKTPIAFAPMTNGLCCTFFPHGGVIAT    281 - 350
GTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMKEFLTYRTF                    351 - 404
//

Text Mined References (12)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20059963 2010 Regulation of interleukin-21 receptor expression and its signal transduction by WSB-2.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.
11819827 2001 Differential expression of a novel colorectal cancer differentiation-related gene in colorectal cancer.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.