Property Summary

NCBI Gene PubMed Count 29
PubMed Score 13.13
PubTator Score 13.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Dental caries 67 0.0 1.0
Myeloid Leukemia 19 0.0 2.0

Expression

  Differential Expression (40)

Disease log2 FC p
hepatocellular carcinoma 1.300 8.0e-03
malignant mesothelioma -3.600 9.7e-07
astrocytic glioma 3.400 6.8e-03
ependymoma 3.800 4.9e-04
oligodendroglioma 4.100 4.1e-04
osteosarcoma -2.580 1.3e-07
glioblastoma 1.700 4.0e-02
group 4 medulloblastoma 2.400 1.4e-03
cystic fibrosis 1.174 7.7e-05
atypical teratoid / rhabdoid tumor 2.200 2.0e-03
medulloblastoma, large-cell 1.500 6.6e-03
primitive neuroectodermal tumor 2.100 9.3e-05
Duchenne muscular dystrophy 1.311 4.3e-07
autosomal dominant Emery-Dreifuss muscul... 1.134 7.5e-03
juvenile dermatomyositis 1.502 1.6e-11
Amyotrophic Lateral Sclerosis 1.194 2.2e-06
acute quadriplegic myopathy 1.231 3.4e-05
tuberculosis -1.100 2.9e-03
pancreatic ductal adenocarcinoma liver m... 2.330 1.4e-03
non-small cell lung cancer -1.469 8.0e-09
intraductal papillary-mucinous adenoma (... 1.500 5.7e-03
intraductal papillary-mucinous carcinoma... 1.100 1.5e-02
lung cancer -2.100 2.8e-05
colon cancer -1.100 2.1e-03
sarcoidosis -1.300 1.5e-02
pediatric high grade glioma 1.400 3.0e-02
pilocytic astrocytoma 1.600 9.2e-04
Pneumonia 1.200 1.5e-02
lung adenocarcinoma 1.264 2.8e-04
psoriasis 1.300 9.4e-06
breast carcinoma -1.100 5.1e-16
Pick disease -1.500 5.3e-03
progressive supranuclear palsy -2.100 1.6e-02
Breast cancer -1.400 1.2e-06
gastric carcinoma 1.300 3.6e-02
ulcerative colitis 1.100 3.0e-03
ovarian cancer -4.000 7.5e-15
Gaucher disease type 1 -2.000 4.6e-02
pancreatic cancer 1.200 1.1e-02
dermatomyositis 1.400 3.4e-03

Gene RIF (10)

PMID Text
26545811 WSB1 up-regulates the expression of HIF-1alpha's target genes and promotes cancer invasion and metastasis through its effect on pVHL
26424695 Our findings show how WSB1 regulates key steps of the metastatic cascade in hypoxia-driven osteosarcoma
24441107 combination of WSB1(3) silencing together with WSB1 isoforms 1+2 silencing in NB cells showed reduced growth, enhanced apoptosis rate, and increased sensitivity to chemotherapeutic agents, specifically related to low expression of WSB1
23792163 HIF1 has a role in regulating WSB-1 expression, which promotes hypoxia-induced chemoresistance in hepatocellular carcinoma cells
20487506 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
18575577 Data on WSB1 regulation support the hypothesis that activation of stress-response mechanisms helps cancer cells establishing metastases and suggest relevance to cancer development of other genes overexpressed in xenografts
18093972 the regulatory mechanisms by which HIPK2 is maintained at a low level, by WSB-1 in cells under normal conditions, and stabilized by genotoxic stresses.
16804916 WSB1 shows strong correlations between expression level and copy number, and also enhances the prognostic prediction when combined with other current prognostic factors in neuroblastoma.
15965468 WSB-1 is part of an E3 ubiquitin ligase for the thyroid-hormone-activating type 2 iodothyronine deiodinase (D2).

AA Sequence

MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNF      1 - 70
LLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQ     71 - 140
LLLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVL    141 - 210
RGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRV    211 - 280
YIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAP    281 - 350
LSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYR    351 - 420
I//

Text Mined References (31)

PMID Year Title
26545811 2015 WSB1 promotes tumor metastasis by inducing pVHL degradation.
26424695 2015 Hypoxia-Induced WSB1 Promotes the Metastatic Potential of Osteosarcoma Cells.
24441107 2014 Potential role of WSB1 isoforms in growth and survival of neuroblastoma cells.
23792163 2013 HIF1 regulates WSB-1 expression to promote hypoxia-induced chemoresistance in hepatocellular carcinoma cells.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
21540461 2011 A genome-wide association study identifies novel loci associated with susceptibility to chronic myeloid leukemia.
20487506 2010 A whole genome association study of mother-to-child transmission of HIV in Malawi.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18575577 2008 The WSB1 gene is involved in pancreatic cancer progression.
18093972 2008 Ubiquitination and degradation of homeodomain-interacting protein kinase 2 by WD40 repeat/SOCS box protein WSB-1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16804916 2006 Increased WSB1 copy number correlates with its over-expression which associates with increased survival in neuroblastoma.
16498413 2006 Structural and functional insights into the B30.2/SPRY domain.
16381901 2006 The LIFEdb database in 2006.
15965468 2005 The Hedgehog-inducible ubiquitin ligase subunit WSB-1 modulates thyroid hormone activation and PTHrP secretion in the developing growth plate.
15601820 2004 VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.
11384984 2001 Muf1, a novel Elongin BC-interacting leucine-rich repeat protein that can assemble with Cul5 and Rbx1 to reconstitute a ubiquitin ligase.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10354473 1999 SWiP-1: novel SOCS box containing WD-protein regulated by signalling centres and by Shh during development.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.