Property Summary

NCBI Gene PubMed Count 21
PubMed Score 327.95
PubTator Score 14.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.027 4.4e-04
ovarian cancer 1.100 1.3e-02

Gene RIF (8)

PMID Text
25139235 results suggest that WRNIP1 functions upstream of Poleta in the response to UV irradiation
23110726 Depletion of Werner helicase interacting protein 1 (WRNIP1) by siRNA enhances HIV-1 Tat activation of HIV-1 LTR, which is not the results of increased Tat expression and release of CDK9/CCNT1 from 7SK snRNP, and activation of NF-kappaB
22209848 Mutated WRNIP1 with a deleted ATPase domain or with mutations in lysine residues accumulated in laser light irradiated sites, suggesting that the ATPase domain of WRNIP1 and ubiquitination of WRNIP1 are dispensable for the accumulation.
20676042 WHIP was identified as a partner/component of the nuclear envelope/nuclear pore complex (NPC) and set forth to investigate a role for the protein positioned at the NPC.
19556710 Data show that that WRNIP1 interacts physically with RAD18 and interferes with the binding of RAD18 to forked DNA and to template/primer DNA.
18842586 analysis of the composite and regulated topography of Wrnip1 in the human nucleus highlights its potential role in replication and other nuclear transactions
17550899 Werner helicase-interacting protein 1 binds polyubiquitin via its zinc finger domain
15670210 These results indicate that WRNIP1 functions as a modulator for initiation or restart events during pol delta-mediated DNA synthesis and that its ATPase activity is utilized to sense DNA ends and to regulate the extent of stimulation.

AA Sequence

MEVSGPEDDPFLSQLHQVQCPVCQQMMPAAHINSHLDRCLLLHPAGHAEPAAGSHRAGERAKGPSPPGAK      1 - 70
RRRLSESSALKQPATPTAAESSEGEGEEGDDGGETESRESYDAPPTPSGARLIPDFPVARSSSPGRKGSG     71 - 140
KRPAAAAAAGSASPRSWDEAEAQEEEEAVGDGDGDGDADADGEDDPGHWDADAAEAATAFGASGGGRPHP    141 - 210
RALAAEEIRQMLQGKPLADTMRPDTLQDYFGQSKAVGQDTLLRSLLETNEIPSLILWGPPGCGKTTLAHI    211 - 280
IASNSKKHSIRFVTLSATNAKTNDVRDVIKQAQNEKSFFKRKTILFIDEIHRFNKSQQDTFLPHVECGTI    281 - 350
TLIGATTENPSFQVNAALLSRCRVIVLEKLPVEAMVTILMRAINSLGIHVLDSSRPTDPLSHSSNSSSEP    351 - 420
AMFIEDKAVDTLAYLSDGDARAGLNGLQLAVLARLSSRKMFCKKSGQSYSPSRVLITENDVKEGLQRSHI    421 - 490
LYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFASEDIGLADPSALTQAVA    491 - 560
AYQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKACLRNHQGPLPPVPLHLRNAPTRLMKDLG    561 - 630
YGKGYKYNPMYSEPVDQEYLPEELRGVDFFKQRRC                                       631 - 665
//

Text Mined References (32)

PMID Year Title
25139235 2014 WRNIP1 functions upstream of DNA polymerase ? in the UV-induced DNA damage response.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22209848 2012 WRNIP1 accumulates at laser light irradiated sites rapidly via its ubiquitin-binding zinc finger domain and independently from its ATPase domain.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20676042 2010 The discovery of a Werner Helicase Interacting Protein (WHIP) association with the nuclear pore complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19556710 2009 Physical and functional interaction between WRNIP1 and RAD18.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18842586 2008 Human Wrnip1 is localized in replication factories in a ubiquitin-binding zinc finger-dependent manner.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17888034 2007 Fibroblast growth factor receptor 1 oncogene partner as a novel prognostic biomarker and therapeutic target for lung cancer.
17550899 2007 Werner helicase-interacting protein 1 binds polyubiquitin via its zinc finger domain.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15670210 2005 Human Werner helicase interacting protein 1 (WRNIP1) functions as a novel modulator for DNA polymerase delta.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11301316 2001 A novel protein interacts with the Werner's syndrome gene product physically and functionally.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.