Property Summary

NCBI Gene PubMed Count 282
PubMed Score 569.70
PubTator Score 487.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Werner syndrome 29 9.007 4.0
Aging, Premature 4 0.0 0.0
Disease Target Count P-value
sonic hedgehog group medulloblastoma 467 3.7e-07
medulloblastoma, large-cell 6241 3.9e-05
psoriasis 6694 1.7e-04
lung cancer 4740 6.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Heart disease 306 0.0 0.9
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 5.0

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.100 1.5e-03
osteosarcoma -2.396 1.5e-04
lung cancer 1.100 6.1e-03
medulloblastoma, large-cell 1.400 3.9e-05
psoriasis -1.500 1.7e-04
sonic hedgehog group medulloblastoma 1.600 3.7e-07

 OMIM Phenotype (1)

Protein-protein Interaction (1)

PDB (10)

Gene RIF (242)

AA Sequence

MSEKKLETTAQQRKCPEWMNVQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDIS      1 - 70
MSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGI     71 - 140
EGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQK    141 - 210
LYAATDAYAGFIIYRNLEILDDTVQRFAINKEEEILLSDMNKQLTSISEEVMDLAKHLPHAFSKLENPRR    211 - 280
VSILLKDISENLYSLRRMIIGSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIREHEVLIHVEDETWDPT    281 - 350
LDHLAKHDGEDVLGNKVERKEDGFEDGVEDNKLKENMERACLMSLDITEHELQILEQQSQEEYLSDIAYK    351 - 420
STEHLSPNDNENDTSYVIESDEDLEMEMLKHLSPNDNENDTSYVIESDEDLEMEMLKSLENLNSGTVEPT    421 - 490
HSKCLKMERNLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCLKMYFGHSSFKPVQWKVIHSV    491 - 560
LEERRDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLISLMEDQVLQLKMSNIPACFLGSAQSENVLTD    561 - 630
IKLGKYRIVYVTPEYCSGNMGLLQQLEADIGITLIAVDEAHCISEWGHDFRDSFRKLGSLKTALPMVPIV    631 - 700
ALTATASSSIREDIVRCLNLRNPQITCTGFDRPNLYLEVRRKTGNILQDLQPFLVKTSSHWEFEGPTIIY    701 - 770
CPSRKMTQQVTGELRKLNLSCGTYHAGMSFSTRKDIHHRFVRDEIQCVIATIAFGMGINKADIRQVIHYG    771 - 840
APKDMESYYQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKMEKYLHSSRCRR    841 - 910
QIILSHFEDKQVQKASLGIMGTEKCCDNCRSRLDHCYSMDDSEDTSWDFGPQAFKLLSAVDILGEKFGIG    911 - 980
LPILFLRGSNSQRLADQYRRHSLFGTGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNW    981 - 1050
LHKANTESQSLILQANEELCPKKLLLPSSKTVSSGTKEHCYNQVPVELSTEKKSNLEKLYSYKPCDKISS   1051 - 1120
GSNISKKSIMVQSPEKAYSSSQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKM   1121 - 1190
RPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMA   1191 - 1260
ITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVIRNPPVNSDMS   1261 - 1330
KISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSS   1331 - 1400
AERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS                                         1401 - 1432
//

Text Mined References (297)

PMID Year Title