Property Summary

NCBI Gene PubMed Count 262
PubMed Score 551.65
PubTator Score 487.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.500 1.7e-04
osteosarcoma -2.396 1.5e-04
medulloblastoma, large-cell 1.400 3.9e-05
lung cancer 1.100 6.1e-03
diabetes mellitus -1.100 1.5e-03
sonic hedgehog group medulloblastoma 1.600 3.7e-07

 OMIM Phenotype (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
651767 summary 0 / 0 / 0 qHTS for Inhibitors of WRN Helicase: Summary
651768 confirmatory 1678 / 6342 / 356305 qHTS for Inhibitors of WRN Helicase
720497 confirmatory 384 / 118 / 109 qHTS for Inhibitors of WRN Helicase: Confirmatory Assay for Cherry-picked Compounds.

Gene RIF (227)

PMID Text
26808708 we provide a proof of concept for applying the external guide sequence (EGS) approach in directing an RNase P RNA to efficiently cleave the WRN mRNA in cultured human cell lines.
26695548 Finfings indicate a role for Werner syndrome helicase WRN as a modulator of DNA repair, replication, and recombination.
26690424 The CC genotype of WRN rs1346044 may contribute to an increased risk and a premature onset of breast cancer.
26420422 WRN prefers to act on DNA strand invasion intermediates in a manner that favours strand invasion and exchange.
26394601 We found statistically significant association with AAO for three genes (WRN, NTN4 and LAMC3) with common associated variants.
26391948 PARylation is involved in the recruitment of RECQL5 and WRN to laser-induced DNA damage and RECQL5 and WRN have differential responses to PARylated PARP1 and Poly(ADP-ribose).
26241669 Multiplex genetic testing of 90 cancer susceptibility genes disclosed a novel WRN frameshift mutation (p.N1370Tfs*23) in a mother and her 2 daughters with cancer and in the youngest unaffected daughter.
26037922 knockdown of WRN reduced TNF-alpha stimulation-induced activation of the endogenous promoter of IL-8, an NF-kappaB-responsive gene, and WRN increased its association with the IL-8 promoter region together with RelA/p50 after TNF-alpha stimulation
25801465 Data indicate that Werner syndrome helicase (WRN)-mediated DNA repair is regulated by SIRT1 deacetylase.
25730140 WRN knockdown decreased the G(O):A-induced A:T --> C:G mutations, suggesting that WRN may enhance the mutations caused by G(O) in the nucleotide pool
25637295 Japanese subjects bearing at least one A allele of rs2230009 of the WRN gene are at a significantly higher risk of femoral fracture, possibly due to decreased bone density.
25468760 The WRN Cys1367Arg (T>C) polymorphism is not associated with overall cancer risk, although subgroup analyses suggested an association with breast cancer and overall cancer specifically in European populations. [meta-analysis]
25456133 A nonenzymatic role for WRN in preserving nascent DNA strands following replication stress, is reported.
25257404 Data suggest that Werner protein (WRNp) may have a role in controlling autophagy and hereby cellular maintenance.
25228686 our results provide first indication of nonredundant participation of WRN and RECQ1 in protection from potentially carcinogenic effects
25178586 a significant interaction with risk of overall Non Hodgkin lymphoma was observed between WRN rs1346044 and hair dye use before 1980.
25170083 The study demonstrated that helicase/ATPase and exonuclease activities of 4-hydroxy-2-nonenal-modified WRN protein were inhibited both in vitro and in immunocomplexes purified from the cell extracts.
25122754 WRN and BLM act epistatically with DNA2 to promote the long-range resection of double strand break ends in human cells.
24989684 The extent to which heterozygosity at the WRN locus may modify the effect of biallelic SAMHD1 mutations is unknown.
24965941 results are consistent with proposed metabolic roles for WRN and genomic instability phenotypes associated with WRN deficiency
24757718 WRN plays a critical role in cancer cell proliferation by contributing to the Warburg effect and preventing metabolic stress.
24709898 Using long-term siRNA knockdown of WRN in three ALT cell lines, we show that some, but not all, cell lines require WRN for telomere maintenance.
24626809 Werner syndrome protein positively regulates XRCC4-like factor transcription.
24608430 The FEN1 E359K germline mutation disrupts the FEN1-WRN interaction and FEN1 GEN activity, causing aneuploidy-associated cancers.
24429382 Indicate that phosphorylation of Ser-440 and -467 in WRN by DNA-PK is important for relocalization of WRN to nucleoli, and that it is required for efficient DSB repair.
24359226 WRN promoter methylation was associated with irinotecan sensitivity in gastric carcinoma.
24308646 Results show increased autophagy in WRN knockdown cells; this was further increased by short-term rapamycin treatment.
23867477 High WRN expression is associated with fanconi anemia.
23849162 We show here for the first time that partial lipodystrophy with severe insulin resistance can reveal WRN-linked premature aging syndrome.
23671665 Data suggest that replication protein A (RPA) brings a complex of SMARCAL1 and WRN to stalled forks, but that they may act in different pathways to promote fork repair and restart.
23619945 A significant interaction of a DNA repair pathway gene WRN and body mass index was observed in T-cell lymphoma.
23523974 The non-synonymous polymorphism at position 114 of the WRN protein affects cholesterol efflux in vitro and correlates with cholesterol levels in vivo.
23334603 C allele of rs1346044, a non-synonymous SNP resulting in the conversion of Cys to Arg at amino acid position 1367 of WRN, alters susceptibility to ARC, especially the cortical type of the disease, in the Han Chinese.
23329665 HSF4 and WRN CNVs might be involved in ARC pathogenesis in the Han Chinese.
23322570 We concluded that WRN genes might be involved in age related cataract pathogenesis in the Han Chinese population.
23253856 WRN is required to support replication fork progression after hydroxyurea-induced stalling.
23045531 WRN improves the efficiency and fidelity of hpol eta to promote more effective replication of DNA.
22989712 The data presented show that the W-V cell line, lacking the WRN protein, does not form the complex telomere mutations derived from inter-telomeric processes.
22871734 WRN prevents large deletions and rearrangements during replication, especially within telomeric regions.
22797812 a relationship between the methylation of the WRN gene and sensitivity to CPT-11 in cervical cancer
22787159 WRN stimulates (CTG)(n) HPR on the template DNA strand by resolving the hairpin so that it can be efficiently used as a template for repair or replicative synthesis.
22766507 Quantitative analysis of WRN exonuclease activity by isotope dilution mass spectrometry.
22713343 the Arg-993 and Phe-1037 in the RQC domain play essential roles in catalytic activity, and in functional interactions mediated by WRN.
22689923 the role of WRN in response to perturbation of replication along common fragile sites is functionally distinct from that carried out at stalled forks genome wide.
22675465 WRNp interacts with the RNA-binding protein, NCL.
22659133 The results indicate that WRN protein regulates HIF-1 activation by affecting mitochondrial ROS production and intracellular ascorbate levels.
22562358 These strong biochemical similarities to human WRN suggest that Drosophila can provide a valuable experimental system for analysing the importance of WRN exonuclease in cell and organismal ageing.
22547774 The patient presents with 5 cardinal and 3 minor features of Werner syndrome, which is an unusual autosomal recessive inherited disorder caused by mutations in the WRN gene on chromosome 8.
22410776 we show that the WRN protein, a member of the human RecQ helicases, is necessary to sustain replication fork progression in response to oncogene-induced replication stress.
22390926 WRN protects U-2 OS osteosarcoma cells against MSeA-induced cytotoxicity, suggesting that oxidative DNA repair pathway is a promising target for improving the efficacy of selenium on tumor suppression.
22351772 Our data highlight the importance of WRN exonuclease activity and its cooperativity with Pol delta in preserving genome stability.
22272300 Data show that Werner syndrome helicase-exonuclease (WRN) bound partial duplexes, bubble and splayed arm DNA and G'2 bimolecular and G4 four-molecular quadruplexes with dissociation constants of 0.25 to 25 nM.
22173703 Single nucleotide polymorphisms in WRN is associated with esophageal cancer.
22159421 WRN has a crucial role in inducing an S-phase checkpoint in cells exposed to the topoisomerase I inhibitors.
22037268 Data suggest that the genetic variant Leu1074Phe in the DNA repair gene WRN might play a role in the risk of prostate cancer in Chinese subjects.
21763283 These results imply that WRN helicase and exonuclease activities can act independently, the uncoordinated action may be relevant to the in vivo activity of WRN.
21736299 findings suggest that, subsequent to fork regression events, WRN and/or BLM could re-establish functional replication forks to help overcome fork blockage
21639834 PML interacts with WRN and regulates double-strand break repair in gamma-irradiation-induced DNA damage responses.
21558813 formation of the WRN megacomplex and recruitment of WRN to TRF2 occur only during S phase
21558802 novel function for XPG in S phase that is, at least in part, performed coordinately with WRN, and which may contribute to the severity of the phenotypes that occur upon loss of XPG.
21389352 Evidence of a functional relationship between WRN and the replication checkpoint and how this cross-talk might contribute to prevent genome instability, a common feature of senescent and cancer cells. Review.
21365542 WRN plays a nexus-like role in the complex interplay of cellular events that regulate aging, and analysis of WRN polymorphisms in Hawaii's population will generate novel insights to advance care for age-related pathologies.
21285356 Non-B DNA-forming sequences and WRN deficiency independently increase the frequency of base substitution in human cells.
21267443 the effects of WRN silencing on cell proliferation and genomic instability are modulated probably by other genetic factors, including p53, which might play a role in the carcinogenesis induced by WRN deficiency.
21210717 Results present the results of a large-scale proteome analysis to determine protein partners of WRN.
21123451 BCR/ABL-mediated stimulation of WRN modulates the efficiency and fidelity of major DSB repair mechanisms to protect leukemia cells from apoptosis and to facilitate genomic instability.
21107010 upon DNA replication blockage, WRN and RPA functionally interact and cooperate to help properly resolve replication forks and maintain genome stability
20855428 age-related decrease in the WRN expression might contribute to human immunosenescence.
20855428 Observational study of gene-disease association. (HuGE Navigator)
20813000 Meta-analysis of gene-disease association. (HuGE Navigator)
20808731 The distribution of the C1367T WRN polymorphism in patients with senile cataract is similar to that in the normal population.
20808731 Observational study of gene-disease association. (HuGE Navigator)
20708636 WRN has a role in processing specific types of homologous recombination intermediates as well as an important function in nonhomologous recombination
20691646 WRN is required to maintain replication fork progression on damaged DNA and facilitates REV1-dependent translesion synthesis.
20657174 clinical case series focusing on an association between pancreatic adenocarcinoma and Werner syndrome;propose that WRN loss-of-function predisposes the development of pancreatic adenocarcinoma through epigenetic silencing or loss-of-heterozygosity of WRN
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20600238 WRN protein participates in the DNA translesion synthesis pathway to prevent genomic instability in an ATM/NBS1-dependent manner.
20585393 studies indicate that environmentally induced replication stress leads to telomere loss and aberrations that are suppressed by telomerase-mediated telomere elongation or WRN functions in replication fork restoration
20522537 Observational study of gene-disease association. (HuGE Navigator)
20516064 Data found that the novel WRN coiled coil domain is necessary for multimerization of the nuclease domain and sufficient to multimerize with full-length WRN in human cells.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20477760 WRNp localizes to the Oct4 promoter during retinoic acid-induced differentiation of human pluripotent cells and associates with the de novo methyltransferase Dnmt3b in the chromatin of differentiating pluripotent cells.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20447876 WRN helicase operates in an EXO1-dependent pathway to help cells survive replicational stress.
20443122 We now report 18 new mutations, including two genomic rearrangements, a deep intronic mutation resulting in a novel exon, a splice consensus mutation leading to utilization of the nearby splice site, and two rare missense mutations.
20428248 CONCLUSION/SIGNIFICANCE: Taken together, these data demonstrate that WRN acetylation regulates its stability and has significant implications regarding the role of acetylation on WRN function in response to DNA damage.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346739 WRN is the only human RecQ helicase that stimulates NEIL1 DNA glycosylase activity, and that this stimulation requires a double-stranded DNA substrate.
20300059 WRN, like its related RecQ family members BLM and Sgs1, operates in a Top3-dependent pathway that is likely to be important for genomic stability.
20157518 WRN processes telomeric DNA substrates with a 3' single-stranded overhang with high specificity and suggest that this protein could influence the configuration of telomere ends prior to the formation of a protective t-loop structure.
20157511 A naturally occurring missense polymorphism in WRN that interferes with helicase activity abolished its ability to restore top3 phenotype. Proposed roles of WRN in genetic pathways important for the suppression of genomic instability are discussed.
20008939 in cells in which both WRN and POT1 are limiting, both G- and C-rich telomeric strands shorten, suggesting a complete replication block
19966859 Results indicate that a depletion of the WRN protein in normal fibroblasts causes the activation of several PKCs through translocation and association of RACK1 with such kinases.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19945966 No evidence was found for an association between WRN V114I (rs2230009), WRN L1074F (rs2725362), or WRN C1367R (rs1346044) and colorectal cancer risk.
19945966 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19896421 results demonstrate that WRN loss confers a strong cellular phenotype in early passage human - though not mouse - primary fibroblasts.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19734539 WRN and BLM preferentially unwind telomeric D-loops containing 8-oxo-2'-deoxyguanosine.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19652551 Cr(VI) induced a rapid dispersal of WRN protein from the nucleolus resulting in its prolonged retention in the nucleoplasm.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19591272 The causative gene of Werner's syndrome is denoted as WRN, which encodes a homolog of the E. coli RecQ DNA helicase and is located on chromosome 8p2-p11.2.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19554081 an additional mechanistic explanation for c-Myc-induced DNA damage and senescence
19502800 The WRN protein affects important pathways in lipidogenesis, adipocytes differentiation and inflammatory response in addition to those affecting DNA damage responses and cell cycle control.
19487340 Demonstrate a novel role for WRN protein in cellular protection against the environmental genotoxicant Cr(VI) and further provide evidence that Cr(VI) induces DNA replicative stress which has implications for aging and cancer.
19282863 Observational study of gene-disease association. (HuGE Navigator)
19262689 POT1v1 and RPA are capable of stimulating WRN helicase on gapped DNA and 5'-overhang substrates, respectively
19205873 The variant genotype of WRN Leu1074Phe was associated with a 1.36-fold significantly increased risk of breast cancer in Chinese women. This variant is also significantly associated with age at menarche.
19205873 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19077115 Observational study of gene-disease association. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
18982914 The clinical features and cellular phenotypes of WS patients are major due to an absolute lack of normal WRN in the nucleus.
18978339 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18852298 WRN is required to avoid accumulation of double-strand breaks and fork collapse after replication perturbation, and that prompt MUS81-dependent generation of DSBs is instrumental for recovery from hydroxyurea-mediated replication arrest.
18830263 Observational study of gene-disease association. (HuGE Navigator)
18771289 Characterization of the single-stranded DNA annealing activity of WRN, in a single region of the WRN molecule.
18677484 WRN gene variant does not affect the in vitro cytotoxicity of topoisomerase inhibitors and platinum compounds.
18677484 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18670736 The data of this study suggest that WRN Cys1367Arg SNP is not involved either in susceptibility to developing gliomas or in patient survival, at least in the Brazilian population.
18670736 WRN Cys1367Arg SNP is not associated with risk and prognosis of human gliomas.
18670736 Observational study of gene-disease association. (HuGE Navigator)
18639560 oxidative stress impacts homologous recombination repair in human helicase mutant WRN mice less than control mice
18596239 WRN and ATM participate in a replication checkpoint response, in which WRN facilitates ATM activation in cells with psoralen DNA cross-link-induced collapsed replication forks
18596042 The Werner syndrome protein binds replication fork and holliday junction DNAs as an oligomer.
18558713 Werner protein (WRN), which is defective in Werner syndrome ( WS) patients, belongs to the RecQ family helicases and interacts with several DNA metabolic proteins, including DNA repair factors and telomere associated proteins.
18524993 altered DNA double-strand break repair in CML cells is caused by the increased activity of an alternative nonhomologous end-joining repair pathway, involving DNA ligase IIIalpha and WRN
18312663 We conclude that in fibroblasts the WRN protein down-regulates plasminogen activator inhibitor 1 expression and after knocking down WRN gene, PAI-1 expression is enchance. Also, polymorphisms in WRN gene significantly contribute to regulate the levels.
18312663 Observational study of gene-disease association. (HuGE Navigator)
18271933 WRN-Cys1367Arg single nucleotide polymorphisms is associated with soft tissue sarcomas, sarcomas with reciprocal chromosomal translocations and malignant fibrous histiocytoma.
18271933 Observational study of gene-disease association. (HuGE Navigator)
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18250621 The RecQ helicase WRN is required for normal replication fork progression after DNA damage or replication fork arrest.
18212065 Exonuclease & helicase activities of WRN are required to suppress telomeric-circle formation in normal cells with telomerase reverse transcriptase. WRN has a key protective function influencing telomere topology & inhibits their accelerated attrition.
18209099 By expressing WRN isoforms impaired in either helicase or exonuclease activity in defective cells, study identified WRN helicase activity as the function required for maintaining the stability of fragile sites.
18203716 SIRT1 regulates WRN-mediated cellular responses to DNA damage through deacetylation of WRN.
18084250 WRN methylation is associated with mucinous differentiation independent of CPG island methylator phenotype and microsatellite instability status.
17996922 SIRT1 protein may be functionally associated with WRN and BLM helicases and that some major SIRT1 functions may not require its deacetylase activity.
17911100 that WRN undergoes metal-catalyzed oxidation in the presence of iron, and iron-mediated oxidation of WRN likely results in the accumulation of a catalytically inactive form of the protein, which may contribute to age-related phenotypes.
17875398 Results show that WRN plays an important role in the protection of HeLa cells against the toxicity of the benzene metabolite hydroquinone, specifically in mounting a normal DNA damage response following the induction of DNA double-strand breaks.
17764108 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17715146 MutSalpha and MutSbeta can strongly stimulate the helicase activity of WRN specifically on forked DNA structures with a 3'-single-stranded arm.
17624410 dual role for WRN in tumorigenesis; tumor suppressor-like activity in tumors with WRN inactivation and the promotion of proliferation and survival in tumors that express WRN
17611195 WRN participates in the same DNA repair pathway as NEIL1.
17563354 WRN interacts functionally with translesion DNA polymerases.
17541157 WRN functions in a RAD18-dependent damage avoidance pathway.
17521388 description of a novel function for WRN in ensuring genome stability to act in concert with Topol to prevent DNA breaks, following alterations in chromatin topology
17317667 WRN is a novel cellular cofactor for HIV-1 replication, and the WRN helicase participates in the recruitment of PCAF/P-TEFb-containing transcription complexes
17317667 Werner syndrome helicase co-localizes with Tat in central nervous system tissue (thalamus and basal ganglia)
17301258 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17266675 These results show cell phenotypes that result from WRN loss in human fibroblasts; delineate the impact of cell transformation on the expression of these phenotypes; and define a role for WRN in the recovery from replication arrest.
17148451 the crystal structure of the human WRN HRDC domain has been determined
17015833 A role for WRN is demonstrated in processing of telomeric DNA and subsequent activation of DNA damage responses.
16906373 A significantly higher level of IgG autoantibody specific for WRN detected in diffuse than in limited type systemic sclerosis and normal may contribute to the pathogenesis of skin sclerosis
16807477 This gene is faulty in a disorder that resembles accelerated aging shuts down in many cancers.
16804003 Possible associations were determined between successful aging and polymorphic markers in the WRN protein.
16738949 Observational study of gene-disease association. (HuGE Navigator)
16728435 Observational study of gene-disease association. (HuGE Navigator)
16723399 These findings highlight the importance of WRN epigenetic inactivation in human cancer, leading to enhanced chromosomal instability and hypersensitivity to chemotherapeutic drugs.
16673358 Two novel mutations within the WRN gene are associated with Werner syndrome.
16622405 WRN-exo is a human DnaQ family member and support DnaQ-like proofreading activities stimulated by Ku70/80, with implications for WRN functions in age-related pathologies and maintenance of genomic integrity
16449207 The Werner syndrome protein plays a direct role in the repair of methylation-induced DNA damage, and suggest a role for both helicase and exonuclease activities together with DNA polymerase beta during base excision repair.
16412221 if a DNA oligomer complementary to one strand of the DNA substrate to be unwound is added during the helicase reaction, both WRN and BLM unwinding is enhanced, presumably by preventing protein-mediated re-annealing
16405962 Observational study of gene-disease association. (HuGE Navigator)
16380375 Results demonstrate that Werner syndrome helicase activity is inhibited in a strand-specific manner by BaP DE-dG adducts only when on the translocating strand.
16339893 solution structure of the DNA- and protein-binding domain, the first of a WRN fragment, has been solved by NMR
16287861 Withdrawal of WRN produced accelerated cellular senescence phenotype and DNA damage response in normal fibroblasts
16223718 report the identification of two additional factors required in the DNA interstrand cross-links repair process, a previously characterized pre-mRNA splicing complex composed of Pso4/Prp19 and Werner syndrome protein(WRN)
16150736 A site-directed mutation at Lys-1016 significantly decreased WRN binding to fork or bubble DNA substrates. DNA binding mediated by the RQC domain is crucial for WRN helicase and its coordinated functions.
16132834 Nuclear magnetic resonance study of protein conformation.
16098926 Observational study of gene-disease association. (HuGE Navigator)
16098926 The 1367 Arg allele of the WRN gene protects against the development of type 2 diabetes mellitus in Japanese.
16087220 Results suggest that WRN protein trafficking is DNA damage-specific and is related to its post-translational modulation.
16030011 POT1 and RecQ helicases WRN and BLM have cooperative roles in resolving DNA structures at telomeric ends, in a manner that protects the telomeric 3' tail as it is exposed during unwinding
15995249 Results suggest that nuclear DNA helicase II plays a role in promoting the DNA processing function of Werner syndrome helicase, which in turn might be necessary for maintaining genomic stability.
15965237 physical interaction between RPA and WRN or BLM helicases plays an important role in the mechanism for RPA stimulation of helicase-catalyzed DNA unwinding.
15845538 WRN, BLM, and dmRecQ5b have a novel strand pairing capability that, when coordinated with the well established helicase activity, endows these RecQ helicases with a strand exchange function
15733840 a novel pathway in which Nbs1 may recruit WRN to the site of DNA double strand breaks in an ATM-dependent manner
15591207 cells lacking WRN exhibit deletion of telomeres from single sister chromatids;it is proposed that WRN is necessary for efficient replication of G-rich telomeric DNA, preventing telomere dysfunction and consequent genomic instability
15489508 R834C is a missense amino acid polymorphism in WRN that nearly abolishes enzymatic activity while leaving expression largely unaffected
15467456 These results suggest a functional relationship between WRN and the MRE11 complex in response to replication fork arrest, disclosing a common action of WRN and the MRE11 complex in the pathway(s) preserving genome stability during DNA replication.
15385537 WRN helicase activity is regulated in human base excision repair
15336909 a functional interaction between Werner syndrome protein and two factors that bind to DNA breaks, Ku and poly(ADP-ribose) polymerase 1--REVIEW
15246744 Observational study of gene-disease association. (HuGE Navigator)
15246744 C/R polymorphism of WRN does not affect enzyme function or localization and does not influence the incidence of the coronary artery disease
15187093 kinetic analysis of helicase and exonuclease activities of WRN
15149862 WRN and TP53 perform different functions in a shared DNA damage response pathway.
15084309 WRN missense mutations or polymorphisms could promote genetic instability and cancer in the general population by selectively interfering with recombination in somatic cells
15037256 results suggest that VCP plays a mechanistic role in releasing WRNp from the nucleolus
15026416 WRN associates with the Mre11 complex via binding to Nbs1 in vitro and in vivo.
14734561 (ADP-ribosyl)ation of Ku70/80 reduces the ability of this factor to stimulate WRN exonuclease, suggesting that covalent modification of Ku70/80 by PARP-1 may play a role in the regulation of the exonucleolytic activity of WRN.
14657243 WRN effectively stimulates FEN-1 cleavage of branch-migrating double-flap structures that are the physiological substrates of FEN-1 during replication.
14612404 the WRN/PARP-1 complex plays a key role in the cellular response to oxidative stress and alkylating agents, suggesting a role for these proteins in the base excision DNA repair pathway
14596914 interaction of ADPRT and WRN resulting in ADP-ribosylation of the WRN protein; results imply that WRN is involved in DNA replication and in DNA repair
14534320 Werner syndrome protein contains three structure-specific DNA binding domains
14499497 Human replication protein A, by engaging in both protein-protein and protein-DNA interactions, facilitates unwinding catalyzed by WRN helicase during DNA synthetic processes.
12944467 we have identified a direct binding between WRN and c-Abl in vitro via the N-terminal and central regions of WRN and the Src homology domain 3 of c-Abl. These findings suggest a novel signaling pathway
12937274 valosin /WRNp interaction plays an important role in Werner syndrome biology
12934712 The balanced exonuclease and helicase activities of Werner protein are required for optimal homologous recombination. Moreover, Werner protein appears to play a structural role, independent of its enzymatic activities.
12842909 results demonstrate that MYC directly stimulates transcription of WRN; propose that WRN up-regulation by MYC may promote MYC-driven tumorigenesis by preventing cellular senescence
12810661 WRN plays a role in the activation of G2 decatenation checkpoint. The abortive function of this pathway itself does not appear sufficient to cause genomic instability. It predisposes to genomic instability & apoptosis in the absence of "caretaker" genes.
12750383 coordinated WRN and RAD52 activities are involved in replication fork rescue after DNA damage
12704184 The functional interaction between WRN and EXO-1 is mediated by a protein domain of WRN which interacts with flap endonuclease 1.
12665521 stimulates DNA polymerase beta strand displacement synthesis via its helicase activity
12633936 PCNA binds to two distinct functional sites on WRN
12629512 WRN is phosphorylated through an ATR/ATM dependent pathway in response to replication blockage, WRN phosphorylation is not essential for its subnuclear relocalization after replication arrest. WRN and ATR colocalize after replication fork arrest
12384494 DNA damage-induced translocation is regulated by acetylation
12356323 interaction of the WRN gene product with human 5' flap endonuclease/5'-3' exonuclease (FEN-1)
12244128 A nucleolar targeting sequence in this protein resides within amino acid residues 949-1092.
12242278 physiological role for the WRN RecQ helicase protein in RAD51-dependent homologous recombination
12181313 binding by and stimulation of by telomere-binding proteing TRF2
12177300 Ku heterodimer binds to both ends of the Werner protein and functional interaction occurs at the Werner N-terminus
12080066 recombinant p53 binds to BLM and WRN helicases and attenuates their ability to unwind synthetic Holliday junctions in vitro
12034829 Distinct proteins encoded by alternative transcripts of the PURG gene, located contrapodal to WRN on chromosome 8, determined by differential termination/polyadenylation.
11971179 WRN helicase accelerates the transcription of ribosomal RNA as a component of an RNA polymerase I-associated complex
11919194 Colocalization, physical, and functional interaction between Werner and Bloom syndrome proteins
11863428 The active form of this minimal exonuclease fragment of human WRN appears to be a hexamer.
11809708 Lack of WRN results in extensive deletion at nonhomologous joining ends.
11798788 Observational study of gene-disease association. (HuGE Navigator)
11498731 Observational study of gene-disease association. (HuGE Navigator)
11328876 A functional interaction of Ku with Werner exonuclease facilitates digestion of DNA containing 8-oxoadenine and 8-oxoguanine modifications.
11186893 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)

AA Sequence

MSEKKLETTAQQRKCPEWMNVQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDIS      1 - 70
MSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGI     71 - 140
EGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQK    141 - 210
LYAATDAYAGFIIYRNLEILDDTVQRFAINKEEEILLSDMNKQLTSISEEVMDLAKHLPHAFSKLENPRR    211 - 280
VSILLKDISENLYSLRRMIIGSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIREHEVLIHVEDETWDPT    281 - 350
LDHLAKHDGEDVLGNKVERKEDGFEDGVEDNKLKENMERACLMSLDITEHELQILEQQSQEEYLSDIAYK    351 - 420
STEHLSPNDNENDTSYVIESDEDLEMEMLKHLSPNDNENDTSYVIESDEDLEMEMLKSLENLNSGTVEPT    421 - 490
HSKCLKMERNLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCLKMYFGHSSFKPVQWKVIHSV    491 - 560
LEERRDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLISLMEDQVLQLKMSNIPACFLGSAQSENVLTD    561 - 630
IKLGKYRIVYVTPEYCSGNMGLLQQLEADIGITLIAVDEAHCISEWGHDFRDSFRKLGSLKTALPMVPIV    631 - 700
ALTATASSSIREDIVRCLNLRNPQITCTGFDRPNLYLEVRRKTGNILQDLQPFLVKTSSHWEFEGPTIIY    701 - 770
CPSRKMTQQVTGELRKLNLSCGTYHAGMSFSTRKDIHHRFVRDEIQCVIATIAFGMGINKADIRQVIHYG    771 - 840
APKDMESYYQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKMEKYLHSSRCRR    841 - 910
QIILSHFEDKQVQKASLGIMGTEKCCDNCRSRLDHCYSMDDSEDTSWDFGPQAFKLLSAVDILGEKFGIG    911 - 980
LPILFLRGSNSQRLADQYRRHSLFGTGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNW    981 - 1050
LHKANTESQSLILQANEELCPKKLLLPSSKTVSSGTKEHCYNQVPVELSTEKKSNLEKLYSYKPCDKISS   1051 - 1120
GSNISKKSIMVQSPEKAYSSSQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKM   1121 - 1190
RPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMA   1191 - 1260
ITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVIRNPPVNSDMS   1261 - 1330
KISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSS   1331 - 1400
AERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS                                         1401 - 1432
//

Text Mined References (276)

PMID Year Title
26808708 2016 Targeted inhibition of WRN helicase by external guide sequence and RNase P RNA.
26695548 2016 Replication stress induced site-specific phosphorylation targets WRN to the ubiquitin-proteasome pathway.
26690424 2015 Association of the rs1346044 Polymorphism of the Werner Syndrome Gene RECQL2 with Increased Risk and Premature Onset of Breast Cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26420422 2015 The DNA structure and sequence preferences of WRN underlie its function in telomeric recombination events.
26394601 2015 Family-based genome scan for age at onset of late-onset Alzheimer's disease in whole exome sequencing data.
26391948 2015 Differential and Concordant Roles for Poly(ADP-Ribose) Polymerase 1 and Poly(ADP-Ribose) in Regulating WRN and RECQL5 Activities.
26241669 2015 A Novel WRN Frameshift Mutation Identified by Multiplex Genetic Testing in a Family with Multiple Cases of Cancer.
26037922 2015 The Werner Protein Acts as a Coactivator of Nuclear Factor ?B (NF-?B) on HIV-1 and Interleukin-8 (IL-8) Promoters.
25801465 2015 WRN translocation from nucleolus to nucleoplasm is regulated by SIRT1 and required for DNA repair and the development of chemoresistance.
25730140 2015 Action-at-a-distance mutagenesis induced by oxidized guanine in Werner syndrome protein-reduced human cells.
25637295 2015 A missense single nucleotide polymorphism, V114I of the Werner syndrome gene, is associated with risk of osteoporosis and femoral fracture in the Japanese population.
25468760 2016 Association Between WRN Cys1367Arg (T>C) and Cancer Risk: A Meta-analysis.
25456133 2014 Nonenzymatic role for WRN in preserving nascent DNA strands after replication stress.
25257404 2014 Transient overexpression of Werner protein rescues starvation induced autophagy in Werner syndrome cells.
25228686 Cellular deficiency of Werner syndrome protein or RECQ1 promotes genotoxic potential of hydroquinone and benzo[a]pyrene exposure.
25178586 2014 Polymorphisms in DNA repair genes, hair dye use, and the risk of non-Hodgkin lymphoma.
25170083 2014 Catalytic activities of Werner protein are affected by adduction with 4-hydroxy-2-nonenal.
25122754 2014 DNA2 cooperates with the WRN and BLM RecQ helicases to mediate long-range DNA end resection in human cells.
24989684 2014 Atypical Aicardi-Goutieres syndrome: is the WRN locus a modifier?
24965941 2014 Acetylation of Werner syndrome protein (WRN): relationships with DNA damage, DNA replication and DNA metabolic activities.
24757718 2014 Downregulation of the Werner syndrome protein induces a metabolic shift that compromises redox homeostasis and limits proliferation of cancer cells.
24709898 2014 WRN loss induces switching of telomerase-independent mechanisms of telomere elongation.
24626809 2014 Werner syndrome protein positively regulates XRCC4-like factor transcription.
24608430 2015 The FEN1 E359K germline mutation disrupts the FEN1-WRN interaction and FEN1 GEN activity, causing aneuploidy-associated cancers.
24429382 2014 Serines 440 and 467 in the Werner syndrome protein are phosphorylated by DNA-PK and affects its dynamics in response to DNA double strand breaks.
24359226 2013 Correlation between the methylation of SULF2 and WRN promoter and the irinotecan chemosensitivity in gastric cancer.
24308646 2014 Rapamycin decreases DNA damage accumulation and enhances cell growth of WRN-deficient human fibroblasts.
24308539 2013 Systematic genomic identification of colorectal cancer genes delineating advanced from early clinical stage and metastasis.
24126761 2013 hPrimpol1/CCDC111 is a human DNA primase-polymerase required for the maintenance of genome integrity.
23867477 2013 Werner syndrome helicase has a critical role in DNA damage responses in the absence of a functional fanconi anemia pathway.
23849162 2013 Partial lipodystrophy with severe insulin resistance and adult progeria Werner syndrome.
23671665 2013 Identification and characterization of SMARCAL1 protein complexes.
23619945 2013 Polymorphisms in DNA repair pathway genes, body mass index, and risk of non-Hodgkin lymphoma.
23523974 2013 The non-synonymous polymorphism at position 114 of the WRN protein affects cholesterol efflux in vitro and correlates with cholesterol levels in vivo.
23334603 2013 Polymorphisms of the WRN gene and DNA damage of peripheral lymphocytes in age-related cataract in a Han Chinese population.
23329665 2013 Copy number variations of DNA repair genes and the age-related cataract: Jiangsu Eye Study.
23322570 2013 The associations between single nucleotide polymorphisms of DNA repair genes, DNA damage, and age-related cataract: Jiangsu Eye Study.
23253856 2013 Distinct functions of human RECQ helicases WRN and BLM in replication fork recovery and progression after hydroxyurea-induced stalling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23045531 2012 Enhancement of human DNA polymerase ? activity and fidelity is dependent upon a bipartite interaction with the Werner syndrome protein.
22989712 2012 The roles of WRN and BLM RecQ helicases in the Alternative Lengthening of Telomeres.
22871734 2012 Werner syndrome protein suppresses the formation of large deletions during the replication of human telomeric sequences.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22797812 2012 Association of epigenetic inactivation of the WRN gene with anticancer drug sensitivity in cervical cancer cells.
22787159 2012 The Werner syndrome protein promotes CAG/CTG repeat stability by resolving large (CAG)(n)/(CTG)(n) hairpins.
22766507 2012 Quantitative analysis of WRN exonuclease activity by isotope dilution mass spectrometry.
22713343 2012 DNA binding residues in the RQC domain of Werner protein are critical for its catalytic activities.
22689923 2012 Perturbed replication induced genome wide or at common fragile sites is differently managed in the absence of WRN.
22675465 2012 Nucleolin inhibits G4 oligonucleotide unwinding by Werner helicase.
22659133 2012 The Werner syndrome gene product (WRN): a repressor of hypoxia-inducible factor-1 activity.
22562358 2013 The Drosophila orthologue of progeroid human WRN exonuclease, DmWRNexo, cleaves replication substrates but is inhibited by uracil or abasic sites : analysis of DmWRNexo activity in vitro.
22547774 2012 Teaching neuroimages: a prematurely aging patient presenting with severe leukoaraiosis and stroke.
22410776 2013 The WRN and MUS81 proteins limit cell death and genome instability following oncogene activation.
22390926 2012 Targeting Werner syndrome protein sensitizes U-2 OS osteosarcoma cells to selenium-induced DNA damage response and necrotic death.
22351772 2012 The Werner syndrome exonuclease facilitates DNA degradation and high fidelity DNA polymerization by human DNA polymerase ?.
22272300 2012 The Werner syndrome protein is distinguished from the Bloom syndrome protein by its capacity to tightly bind diverse DNA structures.
22173703 2012 Esophageal cancer risk is associated with polymorphisms of DNA repair genes MSH2 and WRN in Chinese population.
22159421 2011 WRN helicase regulates the ATR-CHK1-induced S-phase checkpoint pathway in response to topoisomerase-I-DNA covalent complexes.
22037268 2011 Single nucleotide polymorphism WRN Leu1074Phe is associated with prostate cancer susceptibility in Chinese subjects.
21763283 2011 DNA secondary structure of the released strand stimulates WRN helicase action on forked duplexes without coordinate action of WRN exonuclease.
21736299 2011 The Werner and Bloom syndrome proteins help resolve replication blockage by converting (regressed) holliday junctions to functional replication forks.
21639834 2011 Promyelocytic leukemia protein interacts with werner syndrome helicase and regulates double-strand break repair in ?-irradiation-induced DNA damage responses.
21558813 2011 Cell cycle-regulated association between the Werner syndrome protein and its molecular partners.
21558802 2011 The DNA repair endonuclease XPG interacts directly and functionally with the WRN helicase defective in Werner syndrome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21389352 2011 The Werner syndrome protein: linking the replication checkpoint response to genome stability.
21365542 2011 The Werner's Syndrome RecQ helicase/exonuclease at the nexus of cancer and aging.
21285356 2011 Non-B DNA-forming sequences and WRN deficiency independently increase the frequency of base substitution in human cells.
21269460 2011 Initial characterization of the human central proteome.
21267443 2011 Comparison of proliferation and genomic instability responses to WRN silencing in hematopoietic HL60 and TK6 cells.
21210717 2011 Proteome-wide identification of WRN-interacting proteins in untreated and nuclease-treated samples.
21123451 2011 BCR/ABL stimulates WRN to promote survival and genomic instability.
21107010 2011 Molecular cooperation between the Werner syndrome protein and replication protein A in relation to replication fork blockage.
20855428 2011 Aging is accompanied by a progressive decrease of expression of the WRN gene in human blood mononuclear cells.
20813000 2010 Polymorphisms in DNA repair genes and risk of non-Hodgkin lymphoma in a pooled analysis of three studies.
20808731 2010 Lack of association of the WRN C1367T polymorphism with senile cataract in the Israeli population.
20802463 2010 ATR and ATM differently regulate WRN to prevent DSBs at stalled replication forks and promote replication fork recovery.
20708636 2010 Depletion of Werner helicase results in mitotic hyperrecombination and pleiotropic homologous and nonhomologous recombination phenotypes.
20691646 2010 The Werner's Syndrome protein collaborates with REV1 to promote replication fork progression on damaged DNA.
20657174 2010 Werner syndrome as a hereditary risk factor for exocrine pancreatic cancer: potential role of WRN in pancreatic tumorigenesis and patient-tailored therapy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20600238 2010 WRN participates in translesion synthesis pathway through interaction with NBS1.
20585393 2010 The Werner syndrome protein suppresses telomeric instability caused by chromium (VI) induced DNA replication stress.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20516064 2010 Identification of a coiled coil in werner syndrome protein that facilitates multimerization and promotes exonuclease processivity.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20477760 2010 A role for the Werner syndrome protein in epigenetic inactivation of the pluripotency factor Oct4.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20447876 2010 Delineation of WRN helicase function with EXO1 in the replicational stress response.
20443122 2010 WRN mutations in Werner syndrome patients: genomic rearrangements, unusual intronic mutations and ethnic-specific alterations.
20428248 2010 Acetylation of WRN protein regulates its stability by inhibiting ubiquitination.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20346739 2010 Substrate specific stimulation of NEIL1 by WRN but not the other human RecQ helicases.
20300059 2010 Genetic studies of human DNA repair proteins using yeast as a model system.
20159463 2010 Structural basis for DNA strand separation by the unconventional winged-helix domain of RecQ helicase WRN.
20157518 2009 Sequence-specific processing of telomeric 3' overhangs by the Werner syndrome protein exonuclease activity.
20157511 2009 WRN helicase defective in the premature aging disorder Werner syndrome genetically interacts with topoisomerase 3 and restores the top3 slow growth phenotype of sgs1 top3.
20008939 2009 Human POT1 is required for efficient telomere C-rich strand replication in the absence of WRN.
19966859 2010 Depletion of WRN protein causes RACK1 to activate several protein kinase C isoforms.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19945966 2010 Colorectal cancer and polymorphisms in DNA repair genes WRN, RMI1 and BLM.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19896421 2010 Divergent cellular phenotypes of human and mouse cells lacking the Werner syndrome RecQ helicase.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19734539 2009 Telomeric D-loops containing 8-oxo-2'-deoxyguanosine are preferred substrates for Werner and Bloom syndrome helicases and are bound by POT1.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19652551 2009 WRN helicase promotes repair of DNA double-strand breaks caused by aberrant mismatch repair of chromium-DNA adducts.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19591272 2009 [WRN gene].
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19554081 2009 c-Myc accelerates S-phase and requires WRN to avoid replication stress.
19502800 2009 The Werner syndrome protein affects the expression of genes involved in adipogenesis and inflammation in addition to cell cycle and DNA damage responses.
19487340 2009 The Werner syndrome protein functions in repair of Cr(VI)-induced replication-associated DNA damage.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19343720 2009 Identification and characterization of proteins interacting with SIRT1 and SIRT3: implications in the anti-aging and metabolic effects of sirtuins.
19283071 2009 The Werner syndrome helicase/exonuclease processes mobile D-loops through branch migration and degradation.
19282863 2009 Association of candidate gene polymorphisms with chronic kidney disease in Japanese individuals with hypertension.
19262689 2009 Mechanism of Werner DNA helicase: POT1 and RPA stimulates WRN to unwind beyond gaps in the translocating strand.
19205873 2009 A polymorphism in Werner syndrome gene is associated with breast cancer susceptibility in Chinese women.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19116388 2009 A field synopsis on low-penetrance variants in DNA repair genes and cancer susceptibility.
19077115 2009 Replication study of candidate genes for cognitive abilities: the Lothian Birth Cohort 1936.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
18987736 2008 DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
18982914 2008 Model of human aging: recent findings on Werner's and Hutchinson-Gilford progeria syndromes.
18978339 2009 Large-scale evaluation of candidate genes identifies associations between DNA repair and genomic maintenance and development of benzene hematotoxicity.
18852298 2008 Replication fork stalling in WRN-deficient cells is overcome by prompt activation of a MUS81-dependent pathway.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18771289 2008 Intrinsic ssDNA annealing activity in the C-terminal region of WRN.
18677484 2009 The Werner's syndrome 4330T>C (Cys1367Arg) gene variant does not affect the in vitro cytotoxicity of topoisomerase inhibitors and platinum compounds.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18670736 2008 WRN Cys1367Arg SNP is not associated with risk and prognosis of gliomas in Southeast Brazil.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18639560 2008 Effects of human Werner helicase on intrachromosomal homologous recombination mediated DNA deletions in mice.
18596239 2008 WRN is required for ATM activation and the S-phase checkpoint in response to interstrand cross-link-induced DNA double-strand breaks.
18596042 2008 The Werner syndrome protein binds replication fork and holliday junction DNAs as an oligomer.
18558713 2008 Werner protein cooperates with the XRCC4-DNA ligase IV complex in end-processing.
18524993 2008 Up-regulation of WRN and DNA ligase IIIalpha in chronic myeloid leukemia: consequences for the repair of DNA double-strand breaks.
18312663 2008 WRN polymorphisms affect expression levels of plasminogen activator inhibitor type 1 in cultured fibroblasts.
18271933 2008 Association of a missense single nucleotide polymorphism, Cys1367Arg of the WRN gene, with the risk of bone and soft tissue sarcomas in Japan.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
18250621 2008 The RecQ helicase WRN is required for normal replication fork progression after DNA damage or replication fork arrest.
18212065 2008 WRN controls formation of extrachromosomal telomeric circles and is required for TRF2DeltaB-mediated telomere shortening.
18209099 2008 Werner syndrome helicase activity is essential in maintaining fragile site stability.
18203716 2008 Regulation of WRN protein cellular localization and enzymatic activities by SIRT1-mediated deacetylation.
18084250 2008 WRN promoter methylation possibly connects mucinous differentiation, microsatellite instability and CpG island methylator phenotype in colorectal cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17996922 Expression and localization of Werner syndrome protein is modulated by SIRT1 and PML.
17961633 Interaction of human SUV3 RNA/DNA helicase with BLM helicase; loss of the SUV3 gene results in mouse embryonic lethality.
17911100 2007 Metal-catalyzed oxidation of the Werner syndrome protein causes loss of catalytic activities and impaired protein-protein interactions.
17903301 2007 Genome-wide association of echocardiographic dimensions, brachial artery endothelial function and treadmill exercise responses in the Framingham Heart Study.
17875398 2008 Depletion of WRN enhances DNA damage in HeLa cells exposed to the benzene metabolite, hydroquinone.
17764108 2008 Polymorphisms in DNA repair genes, ionizing radiation exposure and risk of breast cancer in U.S. Radiologic technologists.
17715146 2007 Physical and functional interactions between Werner syndrome helicase and mismatch-repair initiation factors.
17624410 Role for the Werner syndrome protein in the promotion of tumor cell growth.
17611195 2007 The human Werner syndrome protein stimulates repair of oxidative DNA base damage by the DNA glycosylase NEIL1.
17563354 2007 Werner syndrome protein interacts functionally with translesion DNA polymerases.
17541157 2007 WRN functions in a RAD18-dependent damage avoidance pathway.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17521388 2007 Werner syndrome protein prevents DNA breaks upon chromatin structure alteration.
17498979 2007 Werner syndrome helicase (WRN), nuclear DNA helicase II (NDH II) and histone gammaH2AX are localized to the centrosome.
17317667 2007 The Werner syndrome helicase is a cofactor for HIV-1 long terminal repeat transactivation and retroviral replication.
17301258 2007 Genetic variation in the premature aging gene WRN: a case-control study on breast cancer susceptibility.
17266675 2007 Functional role of the Werner syndrome RecQ helicase in human fibroblasts.
17148451 2007 Crystal structure of the HRDC domain of human Werner syndrome protein, WRN.
17115688 2006 The Werner and Bloom syndrome proteins catalyze regression of a model replication fork.
17015833 2006 A role for WRN in telomere-based DNA damage responses.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16906373 2006 Significant elevation of IgG anti-WRN (RecQ3 RNA/DNA helicase) antibody in systemic sclerosis.
16807477 2006 The age of cancer.
16804003 2006 Possible associations between successful aging and polymorphic markers in the Werner gene region.
16738949 2006 Polymorphisms in DNA repair genes and risk of non-Hodgkin lymphoma among women in Connecticut.
16728435 2006 Polymorphisms in genes involved in DNA double-strand break repair pathway and susceptibility to benzene-induced hematotoxicity.
16723399 2006 Epigenetic inactivation of the premature aging Werner syndrome gene in human cancer.
16673358 2006 The spectrum of WRN mutations in Werner syndrome patients.
16622405 2006 WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
16449207 2006 The Werner syndrome protein operates in base excision repair and cooperates with DNA polymerase beta.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16412221 2006 Competition between the DNA unwinding and strand pairing activities of the Werner and Bloom syndrome proteins.
16405962 2006 Impact of genetic variations in the WRN gene on age related pathologies and mortality.
16380375 2006 Inhibition of Werner syndrome helicase activity by benzo[a]pyrene diol epoxide adducts can be overcome by replication protein A.
16339893 2005 Solution structure of a multifunctional DNA- and protein-binding motif of human Werner syndrome protein.
16287861 2005 Werner protein protects nonproliferating cells from oxidative DNA damage.
16223718 2005 The Pso4 mRNA splicing and DNA repair complex interacts with WRN for processing of DNA interstrand cross-links.
16150736 2005 Modulation of Werner syndrome protein function by a single mutation in the conserved RecQ domain.
16132834 2005 NMR assignments of the winged-helix domain of human werner syndrome protein.
16098926 2005 WRN gene 1367 Arg allele protects against development of type 2 diabetes mellitus.
16087220 2005 Cellular dynamics and modulation of WRN protein is DNA damage specific.
16030011 2005 POT1 stimulates RecQ helicases WRN and BLM to unwind telomeric DNA substrates.
15995249 2005 Nuclear DNA helicase II (RNA helicase A) interacts with Werner syndrome helicase and stimulates its exonuclease activity.
15965237 2005 Physical and functional mapping of the replication protein a interaction domain of the werner and bloom syndrome helicases.
15845538 2005 RecQ family members combine strand pairing and unwinding activities to catalyze strand exchange.
15735006 2005 p53 modulates RPA-dependent and RPA-independent WRN helicase activity.
15733840 2005 Werner syndrome protein associates with gamma H2AX in a manner that depends upon Nbs1.
15591207 2004 Defective telomere lagging strand synthesis in cells lacking WRN helicase activity.
15489508 2004 The enzymatic activities of the Werner syndrome protein are disabled by the amino acid polymorphism R834C.
15467456 2004 Werner syndrome protein and the MRE11 complex are involved in a common pathway of replication fork recovery.
15385537 2004 Regulation of WRN helicase activity in human base excision repair.
15355988 2004 p14 Arf promotes small ubiquitin-like modifier conjugation of Werners helicase.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15336909 2004 The Werner syndrome protein at the crossroads of DNA repair and apoptosis.
15246744 2004 Werner syndrome protein 1367 variants and disposition towards coronary artery disease in Caucasian patients.
15187093 2004 Biochemical and kinetic characterization of the DNA helicase and exonuclease activities of werner syndrome protein.
15149862 2004 Distinct functions for WRN and TP53 in a shared pathway of cellular response to 1-beta-D-arabinofuranosylcytosine and bleomycin.
15084309 2004 The Werner syndrome protein has separable recombination and survival functions.
15037256 Werner syndrome protein directly binds to the AAA ATPase p97/VCP in an ATP-dependent fashion.
15026416 2004 Linkage between Werner syndrome protein and the Mre11 complex via Nbs1.
14734561 2004 Identification and biochemical characterization of a Werner's syndrome protein complex with Ku70/80 and poly(ADP-ribose) polymerase-1.
14688284 2004 Stimulation of flap endonuclease-1 by the Bloom's syndrome protein.
14657243 2004 WRN helicase and FEN-1 form a complex upon replication arrest and together process branchmigrating DNA structures associated with the replication fork.
14612404 2003 Central role for the Werner syndrome protein/poly(ADP-ribose) polymerase 1 complex in the poly(ADP-ribosyl)ation pathway after DNA damage.
14596914 2003 Physical and functional interaction of the Werner syndrome protein with poly-ADP ribosyl transferase.
14534320 2003 Werner syndrome protein contains three structure-specific DNA binding domains.
14499497 The N-terminal domain of the large subunit of human replication protein A binds to Werner syndrome protein and stimulates helicase activity.
12944467 2003 Werner syndrome protein phosphorylation by abl tyrosine kinase regulates its activity and distribution.
12937274 2003 DNA damage modulates nucleolar interaction of the Werner protein with the AAA ATPase p97/VCP.
12934712 2003 WRN, the protein deficient in Werner syndrome, plays a critical structural role in optimizing DNA repair.
12882351 2002 Asymmetry of DNA replication fork progression in Werner's syndrome.
12842909 2003 Werner syndrome protein limits MYC-induced cellular senescence.
12810661 2003 The G2-phase decatenation checkpoint is defective in Werner syndrome cells.
12750383 2003 WRN interacts physically and functionally with the recombination mediator protein RAD52.
12704184 2003 The exonucleolytic and endonucleolytic cleavage activities of human exonuclease 1 are stimulated by an interaction with the carboxyl-terminal region of the Werner syndrome protein.
12665521 2003 The Werner syndrome protein stimulates DNA polymerase beta strand displacement synthesis via its helicase activity.
12633936 2003 Characterisation of the interaction between WRN, the helicase/exonuclease defective in progeroid Werner's syndrome, and an essential replication factor, PCNA.
12629512 2003 Werner's syndrome protein is phosphorylated in an ATR/ATM-dependent manner following replication arrest and DNA damage induced during the S phase of the cell cycle.
12384494 2002 DNA damage-induced translocation of the Werner helicase is regulated by acetylation.
12356323 2002 Biochemical characterization of the WRN-FEN-1 functional interaction.
12244128 2002 A nucleolar targeting sequence in the Werner syndrome protein resides within residues 949-1092.
12242278 2002 Homologous recombination resolution defect in werner syndrome.
12181313 2002 Telomere-binding protein TRF2 binds to and stimulates the Werner and Bloom syndrome helicases.
12177300 2002 Ku heterodimer binds to both ends of the Werner protein and functional interaction occurs at the Werner N-terminus.
12080066 2002 The processing of Holliday junctions by BLM and WRN helicases is regulated by p53.
12067711 2002 Regulation of the Werner helicase through a direct interaction with a subunit of protein kinase A.
12034829 2002 Distinct proteins encoded by alternative transcripts of the PURG gene, located contrapodal to WRN on chromosome 8, determined by differential termination/polyadenylation.
12020873 2002 Analysis of Werner's expression within the brain and primary neuronal culture.
11971179 2002 WRN helicase accelerates the transcription of ribosomal RNA as a component of an RNA polymerase I-associated complex.
11919194 2002 Colocalization, physical, and functional interaction between Werner and Bloom syndrome proteins.
11889123 2002 Werner protein is a target of DNA-dependent protein kinase in vivo and in vitro, and its catalytic activities are regulated by phosphorylation.
11863428 2002 A minimal exonuclease domain of WRN forms a hexamer on DNA and possesses both 3'- 5' exonuclease and 5'-protruding strand endonuclease activities.
11798788 2000 [The role of Werner's syndrome gene in the genetic susceptibility to the type 2 diabetes in Chinese population].
11598021 2001 Werner syndrome protein interacts with human flap endonuclease 1 and stimulates its cleavage activity.
11498731 2001 A polymorphic variant at the Werner helicase (WRN) gene is associated with bone density, but not spondylosis, in postmenopausal women.
11433031 2001 The Bloom's and Werner's syndrome proteins are DNA structure-specific helicases.
11427532 2001 p53 Modulates the exonuclease activity of Werner syndrome protein.
11420665 2001 Diverged nuclear localization of Werner helicase in human and mouse cells.
11328876 2001 A functional interaction of Ku with Werner exonuclease facilitates digestion of damaged DNA.
11301316 2001 A novel protein interacts with the Werner's syndrome gene product physically and functionally.
11252893 2000 The many substrates and functions of ATM.
11186893 2000 Polymorphisms at the Werner locus: II. 1074Leu/Phe, 1367Cys/Arg, longevity, and atherosclerosis.
11161804 2001 The Werner syndrome gene and global sequence variation.
11027336 2000 Werner protein recruits DNA polymerase delta to the nucleolus.
10880505 2000 Functional interaction between Ku and the werner syndrome protein in DNA end processing.
10871376 2000 Potent inhibition of werner and bloom helicases by DNA minor groove binding drugs.
10871373 2000 Characterization of the human and mouse WRN 3'-->5' exonuclease.
10839545 2000 ATM phosphorylation of Nijmegen breakage syndrome protein is required in a DNA damage response.
10783163 2000 Ku complex interacts with and stimulates the Werner protein.
10779560 2000 Nuclear structure in normal and Bloom syndrome cells.
10608806 1999 Substrate specificities and identification of putative substrates of ATM kinase family members.
10373438 1999 Functional and physical interaction between WRN helicase and human replication protein A.
10220139 1999 WRN mutations in Werner syndrome.
10206685 1998 The 1396del A mutation and a missense mutation or a rare polymorphism of the WRN gene detected in a French Werner family with a severe phenotype and a case of an unusual vulvar cancer. Mutations in brief no. 136. Online.
10069711 1999 Polymorphisms at the Werner locus: I. Newly identified polymorphisms, ethnic variability of 1367Cys/Arg, and its stability in a population of Finnish centenarians.
10049920 1999 Evolution of the RECQ family of helicases: A drosophila homolog, Dmblm, is similar to the human bloom syndrome gene.
9989816 1999 Two novel regions of interstitial deletion on chromosome 8p in colorectal cancer.
9774636 1998 Sp1-mediated transcription of the Werner helicase gene is modulated by Rb and p53.
9681877 1998 Effect of age and apoptosis on the mouse homologue of the huWRN gene.
9671808 1998 Structure and function of the human Werner syndrome gene promoter: evidence for transcriptional modulation.
9618508 1998 Nucleolar localization of the Werner syndrome protein in human cells.
9450180 Werner syndrome: characterization of mutations in the WRN gene in an affected family.
9288107 1997 The Werner syndrome protein is a DNA helicase.
9225981 1997 Mutation and haplotype analyses of the Werner's syndrome gene based on its genomic structure: genetic epidemiology in the Japanese population.
9021029 1997 Association of a polymorphic variant of the Werner helicase gene with myocardial infarction in a Japanese population.
8602509 1996 Positional cloning of the Werner's syndrome gene.
1741060 1992 Genetic linkage of Werner's syndrome to five markers on chromosome 8.