Property Summary

NCBI Gene PubMed Count 43
PubMed Score 28.40
PubTator Score 38.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 1.500 4.2e-02
group 3 medulloblastoma 1.200 7.3e-04

Gene RIF (30)

PMID Text
26734725 The interaction of MDC1 with RNF8, but not with ATM requires WRAP53beta, suggesting that WRAP53beta facilitates the former interaction without altering phosphorylation of MDC1 by ATM.
26551349 This study showed that UCA1 and WRAP53 upregulation may serve as novel serum biomarkers for hepatocellular carcinoma diagnosis and prognosis.
26460974 the sub-cellular localization of the WRAP53 protein has a significant impact on breast cancer survival.
26426684 Moreover, our current observations identify the nuclear levels of WRAP53beta as a promising biomarker for the survival of patients with ovarian cancer.
26170453 The telomerase holoenzyme Cajal body-associated protein, TCAB1, was released from telomerase RNA in mitotic cells coincident with TCAB1 delocalization from Cajal bodies.
25854392 Decreasing the expression of WRAP53 using RNA interference technique can enhance the radiosensitivity.
25512560 WRAP53beta as a novel regulator of DSB repair by providing a scaffold for DNA repair factors.
25467444 Study finds that TRiC is required for folding the telomerase cofactor TCAB1, which controls trafficking of telomerase and small Cajal body RNAs (scaRNAs).
25456005 nuclear expression of WRAP53beta promotes tumor cell death in response to radiotherapy and is a promising predictor of radiotherapy response in patients with HNSCC
25134915 Studied the association of a frequent genetic variation in WRAP53, rs2287499 (C/G), with breast cancer risk and prognosis among Iranian-Azeri population.
25070141 The data indicated that TCAB1 might facilitate the occurrence and development of head and neck carcinomas.
24626331 WRAP53 is associated with development and progression of esophageal squamous cell carcinoma
23886136 Intronic mutation outside overlapping regions of p53/wrap53 genes are associated with breast cancer.
23192612 SNPs in WRAP53 (rs2287497 and rs2287498) have stronger association with an ovarian cancer risk than rs1042522 in TP53.
22805008 Examined expression of WRAP53 protein in rectal cancers and analyzed its relationship to the response to preoperative radiotherapy and patient survival.In radiotherapy group, positive WRAP53 in the metastasis correlated with better survival.
22547674 although Cajal bodies are important for recruitment of telomerase, TCAB1 has an additional role in this process that is independent of these structures
21368886 Knockdown of the WRAP53 protein triggers massive apoptosis through the mitochondrial pathway.
21205863 Compound heterozygous mutations in TCAB1 disrupt telomerase localization to Cajal bodies, resulting in misdirection of telomerase RNA to nucleoli, which prevents telomerase from elongating telomeres
21072240 WRAP53 mediates the interaction between SMN and associated proteins, which is important for nuclear targeting of SMN and the subsequent localization of the SMN complex to Cajal bodies
19797907 Studies show that a linked, positively selected allele at the nearby gene WDR79 may be partly responsible for the sequence diversity profile of TP53.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19250907 We have identified a natural antisense transcript of p53, designated Wrap53, that regulates endogenous p53 mRNA levels and further induction of p53 protein by targeting the 5' untranslated region of p53 mRNA.
19179534 identification of telomerase holoenzyme subunit, TCAB1, enriched in Cajal bodies; it associates with active telomerase, telomerase components & small Cajal body RNAs; TCAB1 controls telomerase trafficking & required for telomere synthesis in cancer cells
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18978339 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
17683073 Observational study of gene-disease association. (HuGE Navigator)
17683073 Common variation in TP53 or WDR79 could be associated with ER negative breast cancers.

AA Sequence

MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREG      1 - 70
DPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAED     71 - 140
EGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVE    141 - 210
YAEMVPVLRMVEGDTIYDYCWYSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAA    211 - 280
HSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLYACGSYGRSLG    281 - 350
LYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFD    351 - 420
LDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTE    421 - 490
SGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGTEGGVGELI                491 - 548
//

Text Mined References (52)

PMID Year Title
26734725 2015 The proximity ligation assay reveals that at DNA double-strand breaks WRAP53? associates with ?H2AX and controls interactions between RNF8 and MDC1.
26551349 2016 Investigation of long noncoding RNAs expression profile as potential serum biomarkers in patients with hepatocellular carcinoma.
26460974 2015 The Sub-Cellular Localization of WRAP53 Has Prognostic Impact in Breast Cancer.
26426684 2015 Downregulation of the cancer susceptibility protein WRAP53? in epithelial ovarian cancer leads to defective DNA repair and poor clinical outcome.
26170453 2015 Dynamics of Human Telomerase Holoenzyme Assembly and Subunit Exchange across the Cell Cycle.
25854392 2015 Regulatory effects of WRAP53 on radiosensitivity of laryngeal squamous cell carcinoma cells.
25512560 2014 The scaffold protein WRAP53? orchestrates the ubiquitin response critical for DNA double-strand break repair.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25456005 2015 Nuclear expression of WRAP53? is associated with a positive response to radiotherapy and improved overall survival in patients with head and neck squamous cell carcinoma.
25134915 2014 Single-strand conformational polymorphism analysis of a common single nucleotide variation in WRAP53 gene, rs2287499, and evaluating its association in relation to breast cancer risk and prognosis among Iranian-Azeri population.
25070141 2014 TCAB1: a potential target for diagnosis and therapy of head and neck carcinomas.
24626331 2014 Overexpression of WRAP53 is associated with development and progression of esophageal squamous cell carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23886136 2013 Overlapping region of p53/wrap53 transcripts: mutational analysis and sequence similarity with microRNA-4732-5p.
23685356 2013 HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment.
23192612 2013 Association of common WRAP 53 variant with ovarian cancer risk in the Polish population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22805008 2012 WRAP53 is an independent prognostic factor in rectal cancer- a study of Swedish clinical trial of preoperative radiotherapy in rectal cancer patients.
22547674 2012 Telomerase recruitment requires both TCAB1 and Cajal bodies independently.
21441950 2011 Anthracyclines induce the accumulation of mutant p53 through E2F1-dependent and -independent mechanisms.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21368886 2011 WRAP53 promotes cancer cell survival and is a potential target for cancer therapy.
21205863 2011 Disruption of telomerase trafficking by TCAB1 mutation causes dyskeratosis congenita.
21072240 2010 WRAP53 is essential for Cajal body formation and for targeting the survival of motor neuron complex to Cajal bodies.
20494116 2010 The p53 tumor suppressor: a master regulator of diverse cellular processes and therapeutic target in cancer.
20351177 2010 Specificity and stoichiometry of subunit interactions in the human telomerase holoenzyme assembled in vivo.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19797907 2010 The diversity profile of TP53 is influenced by positive selection on the immediately upstream locus WDR79.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19571673 2009 Wrap53, a novel regulator of p53.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19342896 2009 TCAB1: driving telomerase to Cajal bodies.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19250907 2009 Wrap53, a natural p53 antisense transcript required for p53 induction upon DNA damage.
19179534 2009 A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18978339 2009 Large-scale evaluation of candidate genes identifies associations between DNA repair and genomic maintenance and development of benzene hematotoxicity.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17683073 2007 Common genetic variation in TP53 and its flanking genes, WDR79 and ATP1B2, and susceptibility to breast cancer.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.