Property Summary

NCBI Gene PubMed Count 27
PubMed Score 49.72
PubTator Score 28.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.437 7.2e-05
medulloblastoma, large-cell -1.100 4.8e-04
interstitial cystitis -1.300 7.1e-05
non primary Sjogren syndrome sicca 1.100 1.7e-02
psoriasis -1.700 1.4e-57

 GO Function (1)

Protein-protein Interaction (12)

Gene RIF (11)

PMID Text
26548512 the present study detected abnormal upregulation in the levels of Wnt2b and Wnt7b, and hypothesized that the alterations may be due to the ectopic opening of chromatin structure.
26538547 Forced overexpression of Wnt7B with or without TGFB1 treatment increased Wnt5A protein expression in normal human smooth muscle cells and fibroblasts but not in Idiopathic Pulmonary Fibrosis myofibroblasts where Wnt5A was already highly expressed.
25823570 WNT7B as a novel susceptibility gene for axial length and corneal curvature and is associated with myopia and extreme myopia.
24638982 Results illustrated the critical role of myeloid WNT7B in tumor progression, acting at the levels of angiogenesis, invasion, and metastasis.
23416978 WNT7B can serve as a primary determinant of differential Wnt/beta-catenin activation in pancreatic adenocarcinoma.
23386686 Results suggest that AR-regulated WNT7B signaling is critical for the growth of CRPC and development of the osteoblastic bone response characteristic of advanced prostate cancer.
22949635 Pdgf signaling potentiates Wnt2-Wnt7b signaling to promote high levels of Wnt activity in mesenchymal progenitors that is required for proper development of endoderm-derived organs, such as the lung
22838404 Wnt7B was expressed at high concentrations in regions of active hyperplasia, metaplasia, and fibrotic change in idiopathic pulmonary fibrosis patients.
20634891 Observational study of gene-disease association. (HuGE Navigator)
19863181 Results demonstrated significant up-regulation of WNT-3, WNT-4, WNT-5B, WNT-7B, WNT-9A, WNT-10A, and WNT-16B in patients with CLL compared to normal subjects.
19734317 These data demonstrate that mesenchymal stem cells from mice and humans produce Wnt proteins and TGF-beta1 that respectively stimulate lung fibroblast proliferation and matrix production.

AA Sequence

MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGI      1 - 70
NECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGY     71 - 140
YNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCT    141 - 210
TKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEE    211 - 280
DAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK     281 - 349
//

Text Mined References (28)

PMID Year Title
26548512 2016 Abnormal epigenetic regulation of the gene expression levels of Wnt2b and Wnt7b: Implications for neural tube defects.
26538547 2016 Expression of WNT5A in Idiopathic Pulmonary Fibrosis and Its Control by TGF-? and WNT7B in Human Lung Fibroblasts.
25823570 2015 Identification of myopia-associated WNT7B polymorphisms provides insights into the mechanism underlying the development of myopia.
24638982 2014 Myeloid WNT7b mediates the angiogenic switch and metastasis in breast cancer.
23416978 2014 WNT7B mediates autocrine Wnt/?-catenin signaling and anchorage-independent growth in pancreatic adenocarcinoma.
23386686 2013 Role of WNT7B-induced noncanonical pathway in advanced prostate cancer.
22949635 2012 Wnt ligands signal in a cooperative manner to promote foregut organogenesis.
22838404 2012 WNT7B in fibroblastic foci of idiopathic pulmonary fibrosis.
21732829 2011 Wnt signaling and Dupuytren's disease.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
19863181 2009 Variation in WNT genes expression in different subtypes of chronic lymphocytic leukemia.
19734317 2009 Mesenchymal stem cells produce Wnt isoforms and TGF-beta1 that mediate proliferation and procollagen expression by lung fibroblasts.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16258938 2006 Expression patterns of Wnt genes during development of an anterior part of the chicken eye.
16227623 2005 Processing by convertases is not required for glypican-3-induced stimulation of hepatocellular carcinoma growth.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164427 2004 Wnt genes define distinct boundaries in the developing human brain: implications for human forebrain patterning.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429992 2002 Regulation of WNT signaling molecules by retinoic acid during neuronal differentiation in NT2 cells: threshold model of WNT action (review).
12239632 2002 Expression of WNT7A in human normal tissues and cancer, and regulation of WNT7A and WNT7B in human cancer.
11562755 2001 Molecular cloning and characterization of human WNT7B.
10866835 2000 The evolutionarily conserved porcupine gene family is involved in the processing of the Wnt family.
10591208 1999 The DNA sequence of human chromosome 22.
9284940 1997 Assignment of WNT7B to human chromosome band 22q13 by in situ hybridization.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8168088 1994 Differential expression of human Wnt genes 2, 3, 4, and 7B in human breast cell lines and normal and disease states of human breast tissue.
8167409 1993 Wnt family proteins are secreted and associated with the cell surface.