Property Summary

NCBI Gene PubMed Count 68
PubMed Score 134.56
PubTator Score 91.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 9.9e-05

Gene RIF (48)

PMID Text
26388562 Wnt7a is involved in the transformation of the retinal pigment epithelium.
26055144 Wnt7a overexpression is associated with an unfavorable prognosis and that positive Wnt7a may be an independent prognosis factor influencing OS and DFS prediction in colorectal cancer patients.
25978974 this is the first study reporting reduced WNT7A levels in cervical cancer -derived cells and that ectopic WNT7A restoration negatively affects cell proliferation and migration.
25728679 identified Iloprost, a prostacyclin analog, which initiates downstream signaling cascades similar to that of Wnt7a, as a novel inducer of cellular senescence, presenting potential future clinical translational strategies
25705850 Wnt7a has a role in specifying the fate of neural crest-like cells via suppression of notch in the human skin microenvironment
25653486 loss of the Wnt7a gene induced by promoter methylation might be a prognostic factor for non-small cell lung carcinoma
25632963 Prognosis was significantly more favorable for patients with high Wnt7A expression.
25030175 findings suggest a central role of the WNT7A-PAX6 axis in corneal epithelial cell fate determination, and point to a new strategy for treating corneal surface diseases
24711502 Binding of Wnt7a to Fzd7 leads to an activation of noncanonical Wnt signaling, resulting in directed myogenic stem cell migration and enhanced engraftment.
23727605 Novel mutations in the WNT7A gene in two unrelated cases of Al-Awadi Raas-Rothschild syndrome.
23321718 Overexpression of Wnt7a may contribute to the progression of endometrial cancer and thus may serve as a new biomarker to predict the prognosis of endometrial cancer.
23056560 WNT7A gene is inactivated by genetic/epigenetic alterations in clear cell RCC and demonstrates tumor suppressor properties
22987443 Gene expression profiling identifies WNT7A as a key SVZ-glial factor lacking in OB-glia that enhances self-renewal, thereby improving the propagation of OB-NSC cultures.
22403725 Wnt7a is lost by methylation in a subset of tumors and that this methylation is maintained by DNMT1
22294752 Wnt7a has a role in postmenstrual regeneration and proliferation of endometrial glands and luminal epithelium in primates
22232518 Reexpression of WNT7A during malignant transformation of ovarian epithelial cells plays a critical role in ovarian cancer progression mediated by WNT/beta-catenin signaling pathway.
22177312 Mutations in the coding sequence of WNT7A are not responsible for mullerian duct abnormalities in the Chinese population.
21344627 The novel missense homozygous mutation (p.Gly204Ser) in the WNT7A gene is a unique mutation in the degree of loss of function in the upper limb development which ranges from mild to complete absence of both upper limbs (amelia).
21271649 Partial loss of WNT7A function resulted in Fuhrmann syndrome, while complete loss of WNT7A function resulted in the more severe phenotype of Al-Awadi-Raas-Rothschild syndrome.
20949531 A novel homozygous missense mutation in coding exon 4 of the WNT7A was detected in both affected daughters (c.664C > T) leading to an amino acid exchange from arginine to tryptophan (p.Arg222Trp; R222W).
20845993 High Wnt7a expression in ovarian cancer may be associated with poor prognosis.
20709709 Abnormalities in the Wnt7a pathway (located in the dorsal ectoderm) produce several clinically relevant conditions.
20503388 Expression levels of Wnt7A, beta-catenin, and FoxA1, along with cell-type specific markers, are observed to vary with differentiation and often also in response to the presence of heparin during the time of exposure to heparin.
20501643 The activity of the Sprouty4 promoter is increased by Wnt7A/Frizzled 9 homolog (Fzd9) signaling through peroxisome proliferator-activated receptor gamma in lung cancer cells.
20470940 Results suggest that this diminished expression of the WNT7A gene may be related to a supposed protection of fragile X syndrome patients to develop cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20219685 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19849868 Female mammals with a deficiency in the product of Wnt7a gene are infertile as a result of abnormal development of the uterus and the oviducts.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19171330 Mutations in the coding sequence of WNT4, WNT5A, WNT7A, and WNT9B are not responsible for the Mayer-Rokitansky-Kuster-Hauser syndrome.
19159115 Based on these results it is unlikely CAND2 and WNT7a are the major genes that causes clubfoot.
19159115 Observational study of gene-disease association. (HuGE Navigator)
19054571 Observational study of gene-disease association. (HuGE Navigator)
18606951 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18538017 WNT7A gene is unlikely to be a major contributor to the aetiology of familial congenital talipes equinovarus
18413325 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18230341 These biological tools could help lead to a better understanding of Wnt-Fzd interactions and the identification of new modulators of Wnt signaling.
17588571 WNT7A plays a role in the pathophysiology of endometriosis.
17201809 the absence of tumour-specific somatic events in WNT7A and HDAC11 suggests that these genes are unlikely to have a classical tumour suppressor gene role in sporadic malignant pancreatic endocrine tumours
16835228 ERK5-dependent activation of PPARgamma represents a major effector pathway mediating the anti-tumorigenic effects of Wnt 7a and Fzd 9 in non-small cell lung cancer cells
16826533 Partial loss of WNT7A causes Fuhrmann syndrome, whereas the more severe limb truncation phenotypes observed in Al-Awadi/Raas-Rothschild/Schinzel phocomelia syndrome result from null mutations.
15802269 By regulating the proliferation of corneal epithelial cells, Wnt-7a and MMP-12 appear to contribute to corneal wound healing
15705594 analysis of multiple Wnt mRNAs in non-small cell lung cancer (NSCLC) cell lines and primary lung tumors revealed markedly decreased Wnt-7a expression compared with normal short-term bronchial epithelial cell lines and normal uninvolved lung tissue
15082716 Wnt-7a is associated with cartilage destruction by regulating the maintenance of differentiation status and the apoptosis of articular chondrocytes via different mechanisms
14550385 WNT7A mutations are an unlikely cause of Mullerian duct derivative abnormalities in humans
12937339 provides support that E-cadherin induction by WNT/beta-catenin signaling is an evolutionarily conserved pathway operative in lung cancer cells and that loss of expression may be important in lung cancer development or progression
12893825 WNT7a gene expression is regulated by TGF-beta1 through the intracellular beta-catenin-TCF pathway

AA Sequence

MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGL      1 - 70
DECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQ     71 - 140
YHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKILEENMKLECKCHGVSGSCT    141 - 210
TKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEE    211 - 280
DPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK     281 - 349
//

Text Mined References (70)

PMID Year Title
26388562 2015 Effect of hrWnt7a on Human Retinal Pigment Epithelial Cells In Vitro.
26342861 2015 Wnts grasp the WIF domain of Wnt Inhibitory Factor 1 at two distinct binding sites.
26055144 2015 Overexpression of Wnt7? protein predicts poor survival in patients with colorectal carcinoma.
25978974 2015 Expression of WNT genes in cervical cancer-derived cells: Implication of WNT7A in cell proliferation and migration.
25728679 2015 Wnt7a is a novel inducer of ?-catenin-independent tumor-suppressive cellular senescence in lung cancer.
25705850 2015 UV-Induced Wnt7a in the Human Skin Microenvironment Specifies the Fate of Neural Crest-Like Cells via Suppression of Notch.
25653486 2015 Clinical significance of aberrant Wnt7a promoter methylation in human non-small cell lung cancer in Koreans.
25632963 2015 Wnt7A is a putative prognostic and chemosensitivity marker in human malignant pleural mesothelioma.
25030175 2014 WNT7A and PAX6 define corneal epithelium homeostasis and pathogenesis.
24711502 2014 Wnt7a stimulates myogenic stem cell motility and engraftment resulting in improved muscle strength.
24449494 2014 Dysfunction of Wnt signaling and synaptic disassembly in neurodegenerative diseases.
23727605 2013 A report of two cases of Al-Awadi Raas-Rothschild syndrome (AARRS) supporting that "apparent" Phocomelia differentiates AARRS from Schinzel Phocomelia syndrome (SPS).
23321718 2013 Overexpression of Wnt7a is associated with tumor progression and unfavorable prognosis in endometrial cancer.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
23056560 2012 Alterations of the WNT7A gene in clear cell renal cell carcinomas.
22988876 2012 The importance of Wnt signalling for neurodegeneration in Parkinson's disease.
22987443 2012 Symmetric expansion of neural stem cells from the adult olfactory bulb is driven by astrocytes via WNT7A.
22986341 2012 Characterization of a Wnt-binding site of the WIF-domain of Wnt inhibitory factor-1.
22403725 2012 Methylation of Wnt7a is modulated by DNMT1 and cigarette smoke condensate in non-small cell lung cancer.
22294752 2012 Dynamic regulation of Wnt7a expression in the primate endometrium: implications for postmenstrual regeneration and secretory transformation.
22232518 2012 WNT7A regulates tumor growth and progression in ovarian cancer through the WNT/?-catenin pathway.
22177312 2012 Variants of the WNT7A gene in Chinese patients with müllerian duct abnormalities.
21670302 2011 Wnt7a signaling promotes dendritic spine growth and synaptic strength through Ca²?/Calmodulin-dependent protein kinase II.
21344627 2011 A novel homozygous missense mutation (c.610G>A, p.Gly204Ser) in the WNT7A gene causes tetra-amelia in two Saudi families.
21271649 2011 Al-Awadi-Raas-Rothschild (limb/pelvis/uterus-hypoplasia/aplasia) syndrome and WNT7A mutations: genetic homogeneity and nosological delineation.
20949531 2010 A novel homozygous Arg222Trp missense mutation in WNT7A in two sisters with severe Al-Awadi/Raas-Rothschild/Schinzel phocomelia syndrome.
20845993 2010 Prognostic role of Wnt7a expression in ovarian carcinoma patients.
20709709 2011 WNT pathways and upper limb anomalies.
20503388 2010 Temporal changes in expression of FoxA1 and Wnt7A in isolated adult human alveolar epithelial cells enhanced by heparin.
20501643 2010 Sprouty-4 inhibits transformed cell growth, migration and invasion, and epithelial-mesenchymal transition, and is regulated by Wnt7A through PPARgamma in non-small cell lung cancer.
20470940 2010 Gene expression profiling identifies WNT7A as a possible candidate gene for decreased cancer risk in fragile X syndrome patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20219685 2010 Pathway-based approaches to imaging genetics association studies: Wnt signaling, GSK3beta substrates and major depression.
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
19849868 2009 The role of genes in the development of Mullerian anomalies: where are we today?
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19171330 2009 Mutational analysis of the WNT gene family in women with Mayer-Rokitansky-Kuster-Hauser syndrome.
19159115 2009 Evaluation of CAND2 and WNT7a as candidate genes for congenital idiopathic clubfoot.
19054571 2009 Polymorphisms in genes involved in neurodevelopment may be associated with altered brain morphology in schizophrenia: preliminary evidence.
18986540 2008 Wnts acting through canonical and noncanonical signaling pathways exert opposite effects on hippocampal synapse formation.
18606951 2008 Association study of Wnt signaling pathway genes in bipolar disorder.
18538017 2008 Variation in WNT7A is unlikely to be a cause of familial congenital talipes equinovarus.
18413325 2008 Variation in WNT genes is associated with non-syndromic cleft lip with or without cleft palate.
18230341 2008 Wnt7a interaction with Fzd5 and detection of signaling activation using a split eGFP.
17588571 2007 Characterization of WNT7A expression in human endometrium and endometriotic lesions.
17431918 2007 Al-Awadi/Raas-Rothschild syndrome: two new cases and review.
17202865 2006 BMP-2-enhanced chondrogenesis involves p38 MAPK-mediated down-regulation of Wnt-7a pathway.
17201809 2007 Mutational analyses of WNT7A and HDAC11 as candidate tumour suppressor genes in sporadic malignant pancreatic endocrine tumours.
16835228 2006 Antitumorigenic effect of Wnt 7a and Fzd 9 in non-small cell lung cancer cells is mediated through ERK-5-dependent activation of peroxisome proliferator-activated receptor gamma.
16826533 2006 Mutations in WNT7A cause a range of limb malformations, including Fuhrmann syndrome and Al-Awadi/Raas-Rothschild/Schinzel phocomelia syndrome.
16258938 2006 Expression patterns of Wnt genes during development of an anterior part of the chicken eye.
15802269 2005 Wnt-7a up-regulates matrix metalloproteinase-12 expression and promotes cell proliferation in corneal epithelial cells during wound healing.
15705594 2005 Restoration of Wnt-7a expression reverses non-small cell lung cancer cellular transformation through frizzled-9-mediated growth inhibition and promotion of cell differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15082716 2004 Wnt-7a causes loss of differentiated phenotype and inhibits apoptosis of articular chondrocytes via different mechanisms.
15040835 2004 Cooperation between TGF-beta and Wnt pathways during chondrocyte and adipocyte differentiation of human marrow stromal cells.
14550385 2003 WNT7A mutations in patients with Müllerian duct abnormalities.
12937339 2003 WNT7a induces E-cadherin in lung cancer cells.
12893825 2003 Transforming growth factor-beta-mediated chondrogenesis of human mesenchymal progenitor cells involves N-cadherin and mitogen-activated protein kinase and Wnt signaling cross-talk.
12857724 2003 Functional characterization of WNT7A signaling in PC12 cells: interaction with A FZD5 x LRP6 receptor complex and modulation by Dickkopf proteins.
12843296 2003 Wnt regulation of progenitor maturation in the cortex depends on Shh or fibroblast growth factor 2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11784006 2001 Estrogen receptor-alpha knockout mice exhibit resistance to the developmental effects of neonatal diethylstilbestrol exposure on the female reproductive tract.
11232041 2001 Decreased expression of Wnt7a mRNA is inversely associated with the expression of estrogen receptor-alpha in human uterine leiomyoma.
11070089 2000 Altered HOX and WNT7A expression in human lung cancer.
9790192 1998 Sexually dimorphic development of the mammalian reproductive tract requires Wnt-7a.
9161407 1997 Isolation of a full-length human WNT7A gene implicated in limb development and cell transformation, and mapping to chromosome 3p25.
8893824 1996 Isolation, characterization and chromosomal assignment of the human WNT7A gene.
8168088 1994 Differential expression of human Wnt genes 2, 3, 4, and 7B in human breast cell lines and normal and disease states of human breast tissue.
8167409 1993 Wnt family proteins are secreted and associated with the cell surface.