Property Summary

NCBI Gene PubMed Count 18
PubMed Score 43.11
PubTator Score 23.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 5.9e-22
breast carcinoma 1614 8.3e-05

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma -1.300 8.3e-05
psoriasis -1.300 5.9e-22

 GO Function (1)

Protein-protein Interaction (7)

Gene RIF (7)

PMID Text
25750203 analysis of missense mutation in WNT6 in couples with unexplained recurrent miscarriage
24935540 WNT6 activates the JNK signaling pathway in HDPCs, leading to migration and differentiation.
22370641 WNT6 and Cav1 are upregulated by chemotherapeutics and enhance the resistance of GC cells to anthracycline drugs
21547848 The WNT6 rs6747776 homozygous minor allele (CC) was associated with increased risk of colorectal adenoma.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20113781 Wnt6 plays an important role in tooth development by promoting human dental papilla cell differentiation, without significant effects on cell proliferation.
16953426 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGAR      1 - 70
LGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGR     71 - 140
APPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAG    141 - 210
RLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPG    211 - 280
RADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVV    281 - 350
QCHRCRVRKELSLCL                                                           351 - 365
//

Text Mined References (18)

PMID Year Title
25750203 2015 Novel missense mutation in WNT6 in 100 couples with unexplained recurrent miscarriage.
24935540 2014 WNT6 promotes the migration and differentiation of human dental pulp cells partly through c-Jun N-terminal kinase signaling pathway.
22370641 2013 WNT6 is a novel target gene of caveolin-1 promoting chemoresistance to epirubicin in human gastric cancer cells.
21547848 2011 Polymorphisms in WNT6 and WNT10A and colorectal adenoma risk.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20113781 2010 Effect of Wnt6 on human dental papilla cells in vitro.
17847007 2007 Mutation in WNT10A is associated with an autosomal recessive ectodermal dysplasia: the odonto-onycho-dermal dysplasia.
16953426 2006 Analysis of candidate genes on chromosome 2 in oral cleft case-parent trios from three populations.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16258938 2006 Expression patterns of Wnt genes during development of an anterior part of the chicken eye.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11350055 2001 WNT10A and WNT6, clustered in human chromosome 2q35 region with head-to-tail manner, are strongly coexpressed in SW480 cells.
10866835 2000 The evolutionarily conserved porcupine gene family is involved in the processing of the Wnt family.
10343101 1999 Partial cloning and assignment of WNT6 to human chromosome band 2q35 by in situ hybridization.
9407023 1997 Wnt signaling: a common theme in animal development.
8167409 1993 Wnt family proteins are secreted and associated with the cell surface.
2279700 1990 Expression of multiple novel Wnt-1/int-1-related genes during fetal and adult mouse development.