Property Summary

NCBI Gene PubMed Count 267
PubMed Score 587.38
PubTator Score 418.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
astrocytoma 1.500 1.7e-12
posterior fossa group A ependymoma 4.100 6.8e-18
psoriasis 2.900 4.8e-12
cutaneous lupus erythematosus 1.800 2.9e-03
glioblastoma 2.100 1.2e-06
osteosarcoma 3.069 1.3e-04
atypical teratoid/rhabdoid tumor 2.300 1.6e-04
medulloblastoma, large-cell -1.300 2.5e-02
Atopic dermatitis 2.100 1.0e-05
tuberculosis and treatment for 3 months -2.100 2.2e-05
non-small cell lung cancer 1.566 9.2e-08
Hydrolethalus syndrome 2.260 6.2e-03
pancreatic cancer 1.300 1.4e-03
breast carcinoma 1.200 1.9e-03
fibroadenoma 1.700 1.7e-03
interstitial cystitis -1.100 5.6e-03
cystic fibrosis -1.200 3.8e-04
pediatric high grade glioma 2.600 1.3e-05
pilocytic astrocytoma 2.400 1.2e-08
sonic hedgehog group medulloblastoma 2.600 1.8e-04
invasive ductal carcinoma 1.730 5.8e-04
Breast cancer -1.200 7.8e-03
ductal carcinoma in situ 1.700 2.1e-03
ulcerative colitis 3.800 7.0e-07
ovarian cancer -4.100 1.3e-10
head and neck cancer -1.300 3.5e-03
head and neck cancer and chronic obstruc... -1.100 8.7e-04

Gene RIF (244)

PMID Text
26997628 Wnt5a is increased and beta-catenin is decreased in parenchyma from idiopathic pulmonary fibrosis patients.
26978652 Epigenetic inactivation of the WNT5A promoter B involves both DNA methylation and histone modifications. Differential expression of the WNT5A alternative promoters A and B is a characteristic of osteosarcomas.
26848991 Studied the roles of WNT4 and WNT5A in human decidulization and their relationship with preeclampsia.
26800561 Noncanonical Wnt5a signaling and JNK activity contribute to vascular insulin resistance and endothelial dysfunction.
26794322 Mutation in WNT5A may serve as a susceptibility factor for Congenital Anomalies Of Kidney And Urinary Tract.
26708384 Wnt5a-Ror2 signaling enhances expression and secretion of CXCL16 in mesenchymal stem cells thereby activating CXCR6 expressed on tumor cells to promote proliferation.
26708300 these findings suggest that miR154 functions as a tumor suppressor in osteosarcoma by partially suppressing Wnt5a expression.
26690702 This study identifies an interaction between ROR1 and ROR2 that is required for Wnt5a signaling that promotes leukemia chemotaxis and proliferation.
26648282 Wnt5a is involved in the modulation of pancreatic cancer cell proliferation.
26596412 results corroborated previous findings of Ryk-mediated Wnt5a effect, and suggested a role for Ror2 in the Wnt5a machinery in glioblastoma
26558991 WNT5A participates in the biology of odontogenic tumors and inflammatory cyst but not in developmental cyst.
26538547 Forced overexpression of Wnt7B with or without TGFB1 treatment increased Wnt5A protein expression in normal human smooth muscle cells and fibroblasts but not in Idiopathic Pulmonary Fibrosis myofibroblasts where Wnt5A was already highly expressed.
26514730 WNT-5A is a crucial signaling molecule under investigation with efforts to not only delineate its signaling mechanisms and functions in physiological and pathological conditions, but also to develop strategies for its therapeutic targeting. [review]
26511503 The results reveal higher WNT-5A protein levels and mRNA expression in a subgroup of gliomas compared to non-malignant control brain tissue. It also showes a significant correlation between WNT-5A in the tumor and presence of microglia/monocytes.
26462870 Study revealed a previously unrecognized immunomodulatory role of endogenous Wnt5A in ovarian cancer cells, which could further influence chemotactic cell migration.
26342861 Data show that the WIF domain of Wnt Inhibitory Factor 1 (WIF1) is bound by C-terminal domains of Wnt proteins Wnt5a and Wnt7a at two sites.
26305508 Findings suggest that high receptor tyrosine kinase-like orphan receptor (ROR) 2 or proto-oncogene protein Wnt-5A (Wnt5a) expression is associated with poor prognosis in non-small cell lung cancer (NSCLC).
26281688 It is involved in tumor initiation, cancer stem cell maintenance and angiogenesis.
26278011 The homozygous genotypes (CC for rs524153 and GG for rs504849) were associated with a lower WNT5A transcriptional level compared with the transcriptional level of those with wild-type genotypes.
26240275 High WNT5A and WNT5B expression strongly associates with unmutated IGHV.
26202350 Knockdown of Wnt5a suppresses the proliferation of keratinocytes and induces apoptosis by inhibiting the Wnt/beta-catenin or Wnt5a/Ca(2+) pathways
26118187 in hepatic stellate cells regulates inflammatory cytokine and collagen production and cell proliferation, independent of the canonical Wnt signaling pathway
26054690 miR-217 functions as a tumor suppressor in osteosarcoma by suppressing Wnt5a expression.
25944911 results provide evidence that Wnt5a induces protein depalmitoylation, which promotes polarized protein localization and cell invasion.
25913759 Osteogenic features of MSCs from ossification of yellow ligament patients are promoted by unmethylated WNT5A.
25823923 Data suggest that WNT5A is an important molecule in promoting stem cell characteristics in NPC, leading to tumorigenesis and metastasis.
25779663 Wnt5a is a potential suppressor of EMT; there is a novel Arf6/ERK signaling pathway for EGF-regulated Wnt5a expression at transcriptional level of gastric cancer cel
25772239 Loss of WIF1 enhances the migratory potential of glioblastoma through WNT5A that activates the WNT/Ca(2+) pathway and MALAT1.
25769722 Heterozygous loss of WNT5A was correlated with shorter survival of breast cancer patients.
25655430 These results suggest that Wnt5a expressed in PDL tissue plays specific roles in inducing collagen production by PDL cells through TGFbeta1-mediated upregulation of periostin expression.
25622531 Wnt5a activated Src family kinases (SFKs) and Wnt5a-dependent cancer cell proliferation was dependent on SFKs, yet blockade of receptor-mediated endocytosis did not affect cancer cell proliferation and SFK activity.
25619716 Wnt5a-Ror2 axis is constitutively activated in cancer cells and confers highly motile and invasive properties on cancer cells through the expression of matrix metalloproteinase genes and enhanced formation of invadopodia.
25454492 Human placenta-derived Wnt-5a induces the expression of ICAM-1 and VCAM-1 in CD133(+)CD34(+)-hematopoietic progenitor cells.
25450290 The Wnt5a/Ca 2+ /calcineurin/nuclear factor of the activated T signaling pathway in melanoma.
25413872 Serum wnt5a gene expression might be a potential biomarker for predicting the prognosis of acute on chronic hepatitis B liver failure.
25410163 In gastric cancer, HNF4alpha regulated WNT signalling through its target gene WNT5A.
25407936 These data point to Wnt5A as a master regulator of an adaptive stress response in melanoma, which may contribute to therapy resistance.
25401518 the Wnt5A signaling pathway was shown to contribute to regulating the drug-resistance protein ABCB1 and beta-catenin-related genes in antagonizing the toxic effects of doxorubicin in cell lines and in clinical breast cancer samples.
25382802 The wnt5a/sFRP5 system is altered in human sepsis and might therefore be of interest for future studies on molecular pathophysiology of this common human disease.
25337253 Upregulation of Wnt5A was associated with metastasis and progression of cervical cancer.
25308364 WNT5A induced chemoresistance by regulation of G1-S transition in pancreatic cancer cells.
25303486 WNT5a acts as a proinflammatory factor in human ovarian granulosa cells. The up-regulated expression of WNT5a in PCOS increases inflammation and oxidative stress predominantly via the phosphatidylinositol 3-kinase/AKT/NF-kappaB signaling pathway.
25240110 Wnt5a has a role in the pathogenesis of atherosclerosis and other inflammatory disorders [review]
25240054 Wnt5a secreted by monocytes signals through the noncanonical Wnt-FZD5 pathway in mECs to induce TF expression that induces angiogenesis by autocrine regulation.
25224731 WNT5A exhibits antitumor effects in prostate cancer cells and may be suitable as a prognostic marker and therapeutic target for prostate cancer and associated skeletal metastases
25204426 This study thus provides evidence that the ability of WNT5A to promote cancer progression is dependent on the cellular context.
25196330 Wnt5a signaling increases IL-12 secretion by human dendritic cells and enhances IFN-gamma production by CD4+ T cells.
25107489 Aberrant methylation of APC gene was statistically significant associated with age over 50, DDK3 with male, SFRP4, WIF1, and WNT5a with increasing tumor stage SFRP4 and WIF1 with tumor differentiation and SFRP2 and SFRP5 with histological type
25031739 Wnt-5a mRNA levels were significantly higher in hepatocellular carcinoma tissue than in the para-carcinoma tissue while Wnt-5a protein was absent or low
25022753 Findings suggest that Wnt5a enhances cell migration through activation of Cdc42 and inactivation of RhoA in human corneal endothelial cells.
24999479 The results demonstrated that overexpression of Wnt5a may play an important role in NSCLC angiogenesis and it may function via canonical Wnt signal pathway.
24993819 The results demonstrate that Wnt5a induces monocyte chemotactic protein 1 production in gastric cancer, which is mediated by IL-1beta.
24972966 the findings suggested that miR-26a may function as a tumor suppressor in prostate cancer by targeting Wnt5a.
24898696 Results show that Wnt5a promoted epithelial-mesenchymal transition via PKCalpha in epithelial ovarian cancer.
24891513 data suggest that Wnt5a, as an inflammatory mediator that drives the integration of cytokines and chemokines, acts downstream of TNF-alpha.
24865425 RNAi-mediated reduction of endogenous WNT5A in melanoma decreased cell growth, increased apoptosis in response to BRAF inhibitor challenge, and decreased the activity of prosurvival AKT signaling.
24840810 Activation of noncanonical Wnt signaling through the up-regulation of WNT5A may promote a proinflammatory state in visceral adipose tissue contributing to the development of obesity-associated comorbidities.
24833087 WIF-1 is frequently methylated and that Wnt5a acts as a tumor suppressor gene in colorectal carcinoma.
24796738 Data indicate that cell migration was inhibited in Wnt5a-inhibited melanoma cells.
24766647 WNT5A induces release of exosomes containing pro-angiogenic and immunosuppressive factors from malignant melanoma cells.
24750404 Our study suggests that wnt5a may play a role in the pathophysiology of psoriasis and its metabolic comorbidity such as insulin resistance.
24716670 De novo WNT5A-associated autosomal dominant Robinow syndrome suggests specificity of genotype and phenotype.
24706725 we demonstrate that innate immune functions of macrophages ensue at least partly through a homeostatic Wnt5a-Fz5-NF-kappaB (p65) circuit, which is Rac1 dependent.
24696716 Wnt5a may act as a tumor-suppressor gene in hepatocellular carcinoma
24658506 establish a directional crosstalk between calcium-sensing receptor and Wnt/beta-catenin signaling in keratinocyte differentiation via Wnt5a that acts as an autocrine stimulus in this process
24647585 Data show that the WNT/beta-CATENIN signaling cascade components, including WNT ligands WNT3 and WNT5A, is crucial for early odontogenesis.
24626628 Results reveal pro-tumorigenic effects of WNT5A in nasopharyngeal carcinoma.
24621529 The Wnt-5a was expressed and correlated with cell motility and infiltrative activity through the regulation of matrix metalloproteinase (MMP)-2 in glioma-derived cells.
24606488 differential Wnt11 immunoexpression in high-grade human serous ovarian cancer compared to low-grade human serous ovarian cancer could play important roles in serous ovarian cancer progression and may be modulated by Wnt5a expression levels.
24603290 SFRP5 and WNT5A comprise a balanced duo that may regulate metabolic homeostasis in prepubertal children.
24518599 WNT5A derived from bone stromal cells induced the expression of BMP-6 by CaP cells; BMP-6 in turn stimulated cellular proliferation of CaP cells.
24464650 Our findings indicate that Wnt5a might act as tumor suppressor by inhibiting cell proliferation and attenuating EMT in colon cancer cells
24416340 Wnt5a overproduction and SFRP5 deficiency in gastric mucosa may together play an important role in gastric inflammation and carcinogenesis.
24399733 Ursolic acid suppressed the expression of Wnt5alpha/beta and beta-catenin, inducing apoptosis in prostate cancer cells.
24395444 The expression levels of Wnt5a, p-JNK1 and p-paxillin in tumor tissues were correlated with each other.
24346691 Wnt5a signals in hCMEC/D3 cells through activation of the Par/aPKC PCP complex, independently of the Wnt canonical beta-catenin-dependent pathway and significantly contributes to TJ integrity and endothelial apicobasal polarity.
24346141 Wnt5a, TLR2 and TLR4 are elevated in advanced human atherosclerotic lesions.
24335906 Wnt5a uses CD146 as a receptor to regulate cell migration.
24293407 findings support a new role for WNT5A in the metabolic reprogramming of cancer cells that is a context- dependent event
24260410 our study provides evidence that the distinct activities of WNT5A in cancer can be attributed to the production of two WNT5A isoforms.
24185202 MV and exosomes are critical for MPhi-induced invasion of cancer cells since they are responsible for upregulation of MPhi-Wnt 5a as well as for its delivery to the recipient cells via a reciprocal loop.
24156409 Upregulation of Wnt5a promotes EMT and metastasis in pancreatic cancer models.
24139281 It plays a important role in pathogenecity of frontotemporal lobar degeneration, which suggests a novel target for the therapeutic intervenion.
24091015 Wnt5a assembles a Wnt-receptor-actin-myosin-polarity structure and directs polarized calcium gradients.
23963164 DEX induces the upregulation of noncanonical Wnt ligand Wnt5a. Recombinant WNT5a protein induces CLAN formation through the noncanonical Wnt receptor ROR2/RhoA/ROCK signaling axis.
23947922 Wnt5a pathway may play a role in the pathogenesis of urothelial carcinoma of the bladder.
23764752 High WNT5A expression is associated with colon cancer.
23748645 Wnt5a signaling pathway may be involved in the malignancy of glioma.
23716599 Inhibition of Wnt5a by either RNAi knockdown or blocking antibody reversed Smarcd3 -induced epithelial-mesenchymal transition. Thus, Smarcd3 epigenetically regulates epithelial-mesenchymal transition by activating WNT signaling pathways.
23679576 Wnt5a inhibits human monocyte-derived myeloid dendritic cell generation.
23660959 Our results suggest that Wnt5a is a major contributing factor to the increase in osteolytic bone lesions and hypercalcemia found in Adult T-cell leukemia/lymphoma patients
23653377 Plasma Wnt5a levels are decreased in patient with type 2 diabetes mellitus.
23615002 WNT5A may play an important role in constructing an advantageous tumor microenvironment for the progression and development of human gastric cancer.
23539626 HIV-1 gp120 upregulates the expression of WNT5a in human neural stem cells
23484019 WNT5A inhibits metastasis and alters splicing of Cd44 in breast cancer cells.
23469623 Our results do not support the relevance of ROR2/Wnt5a as biomarkers in stage 1 pure seminomas
23462101 ARF6 may provide a means of inhibiting WNT/beta-catenin signaling in cancer
23417837 Loss of WNT5A expression due to methylation is related to aggressiveness of sporadic breast cancer.
23396967 Wnt-induced dishevelled 2 phosphorylation has effects in in canonical and noncanonical Wnt3a and Wnt5a signaling
23359789 Both WNT5A and NFATc2 proteins are highly expressed in human pancreatic cancer tissues.
23353182 Wnt5a promotes breast cancer cell migration via the Dvl2/Rab35/Rac1 signaling pathway.
23349696 crucial role of Wnt5a in the smoking-related lung carcinogenesis
23342259 Wnt5a can be used as a predictive biomarker, and favoring the view of Wnt5a as a future therapeutic target in prostate cancer patients with tumor cells displaying low expression of Wnt5a.
23278988 This study demonstrated the first attempt to identify Wnt5a and Ror2 as additional mechanisms contributing to dysregulation of the non-canonical WNT signaling pathway in medulloblastoma. Ror2 may play a role as an oncosuppressor in medulloblastoma.
23271023 Data indicate changed ecpression levels of PRM2, HSP90 and WNT5A in male of couples experiencing idiopathic recurrent miscarriages.
23266365 Wnt5a may be potentially involved in the effects of inflammation on bone formation.
23265959 determined if mutations in WNT5A contributed to the etiology of Mullerian duct abnormalities in 189 Chinese women
23254341 WNT-5A signaling is activated by and necessary for TGF-beta-induced extracellular matrix production by airway smooth muscle cells
23178630 WNT5A was more frequently methylated in early stage gastric carcinomas.
23159080 Wnt5a, APC and beta-catenin genes might be involved in the carcinogenesis and development of colorectal adenocarcinoma. It is hypothesized that down-regulation of APC and Wnt5a proteins may be one of causes of ectopic expression of beta-catenin in CRC.
23075330 Data indicate that Wnt5a mRNA level was correlated positively with CXCR4 mRNA level in Ewing sarcoma (ES) specimens.
23054609 findings suggest that epithelium-derived SFRP5 may play a probable defensive role in impeding gastric cancer progression, characteristically by inhibiting GEC migration induced by macrophage-derived Wnt5a via JNK signaling activation
23046419 Data indicate that Wnt5a promoters, A and B, are differentially regulated and a model for complex transcriptional regulation of Wnt5a.
23001722 EBV-positive gastric carcinoma had no or very low expression of WNT5A but a high level of methylation in the promoter region.
22825874 These results suggest that Wnt5a signaling positions ESCRT-III in the midbody properly for abscission by stabilizing midbody microtubules
22781592 High wnt5a expression is involved in the pathophysiology of Multiple myeloma-induced bone disease.
22694338 Wnt-5a and CYR61 are enriched in the extracellular matrix of liver fibrotic tissue compared with control matrix.
22655072 Wnt5a promotes breast cancer cell migration via Dvl2/Daam1/RhoA.
22609948 Identification of a novel Wnt5a-CK1varepsilon-Dvl2-Plk1-mediated primary cilia disassembly pathway.
22547701 Under proinflammatory conditions the noncanonical Wnt protein Wnt5a induces immunosuppressive macrophages from malignant epithelial cells and in association with tumor-associated macrophages.
22493546 Data suggest that Wnt5a and Ror2 may serve as tumor suppressor genes in the development of hepatocellular carcinoma, and may serve as clinicopathologic biomarkers for prognosis in HCC patients.
22485170 Modulation of Wnt5a expression by P. gingivalis may play an important role in the periodontal inflammatory process.
22384249 Pro-inflammatory wnt5a and anti-inflammatory sFRP5 are differentially regulated by nutritional factors in obese human subjects
22384081 Wnt5a signalling contributes to tissue invasion by non-melanoma skin cancer
22293903 WNT-5a and ROR2 were more highly expressed in more severe disease states, and therefore may play a coordinated role in the occurrence and progression of osteosarcoma
22162112 study underlines the critical role of BMSC-derived WNT5A in the regulation of inflammatory processes and suggests its participation in the pathogenesis of rheumatoid arthritis
22128168 Wnt5a-Ror2 signaling might also be required for expression of MMP-13 gene during the development of the cartilaginous tissue.
22124122 Wnt5a is secreted by follicular dendritic cells to protect germinal center B cells via Wnt/Ca2+/NFAT/NF-kappaB-B cell lymphoma 6 signaling.
22101459 Data suggest that an anti-Wnt5a antibody was capable of suppressing Wnt5a-dependent internalization of Fz2 receptor, resulting in the prevention of metastasis of gastric cancer cells by inhibiting the activation of Rac1 and the expression of laminin gamma2.
22039506 finding together with our in vitro data demonstrating the ability of Wnt5a to impair the invasive properties of prostate cancer cells, suggests a tumor suppressing effect of Wnt5a in localized prostate cancer
21980498 Differentiation paralleled the activation of Wnt5/Calmodulin signalling by autocrine/paracrine intense secretion of Wnt5a and Wnt5b
21918189 under high levels of Wnt5a monocytes could differentiate into unconventional dendritic cells with tolerogenic features.
21871017 GPC6 promotes invasive migration by inhibition of canonical beta-catenin and Wnt signalling, and up-regulation of non-canonical Wnt5A signalling leading to the activation of JNK and p38 MAPK.
21816908 loss of Wnt5a predicts poor outcome in Epithelial ovarian cancer patients and Wnt5a suppresses the growth of cancer cells by triggering cellular senescence
21672426 The expression of Wnt5a in the termina1 rectum decreases in children with anorectal malformation (ARM), suggesting Wnt5a may play an important role in the development of ARM.
21587258 Wnt5a methylation was strongly associated with tumour microsatellite instability tumours after adjustment for age, sex, and tumour location
21461571 Wnt5a was prominently expressed in human primary cytotrophoblast cells, but absent in the human choriocarcinoma cell line JAR.
21431850 Wnt5a plays an important role in human hindgut and anorectal morphogenesis.
21365928 The expression of Wnt5A is significantly increased in chronic rhinosinusitis with nasal polyps compared with controls.
21352264 The loss of Wnt-5 may indicate the invasiveness of extramammary Paget's disease.
21344486 Several members of the WNT pathway, including WNT5A, FZD5, and DKK1 were highly up-regulated in PCa tissue from patients with advanced PCa.
21342370 Results show expression of Wnt5a and Ror2 is induced during Snail-mediated epithelial-mesenchymal transition or malignant progression of cancer cells and that activated Wnt5a-Ror2 signaling confers highly motile and invasive properties on cancer cells.
21285942 Data indicate that macrophages alter adipogenesis of 3T3-L1 cells not only via classical proinflammatory cytokines, but also via wnt signalling molecules.
21270611 Wnt5a plays an important role in regulating chemosensitivity to anticancer drugs in ovarian cancer cells
21209903 PIK3CA mutation and the Wnt pathway have roles in ERalpha-positive breast cancer
21205070 Wnt-5a is not only a prognostic factor but also a therapeutic target molecule in gliomas for preventing tumor cell infiltration.
21165581 WNT5A can act as a suppressor factor in leukemogenesis and can be used as a potential marker for curative effect assessment in leukaemia.
21115903 Hypermethylation of WNT5a is associated with colon cancer.
21069266 Results suggest that Wnt5a plays the role of a tumor suppressor in leukemogenesis through the Wnt5a/Ror2 noncanonical signaling pathway that inhibits Wnt canonical signaling.
20955350 In melanoma cells, expressions of Wnt5A and Klotho are inversely correlated.
20890934 Observational study of gene-disease association. (HuGE Navigator)
20639201 Data found that Wnt5a reduces cell surface levels and promotes ubiquitination and degradation of SDC4.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20603606 Data show that epigenetic disruption of WNT5A would contribute directly to the aberrant activation of WNT/beta-catenin signaling during ESCC pathogenesis.
20554957 Data show that expression of Wnt5a in atherosclerosis and rheumatoid arthritis but not in normal tissue, supporting the role of Wnt5a as an inflammatory mediator in vivo.
20525402 Observational study of gene-disease association. (HuGE Navigator)
20518933 expressions of mineralization-related genes: bone sialoprotein, collagen type I, osteonectin, osteopontin (OCN), dentine matrix protein-1 were up-regulated by Wnt5a. Wnt5a promoted differentiation of HDPCs.
20454608 A quantitative analysis of the expression of Wnt5A protein in human tissue arrays, containing 600 prostate tissue cores, showed >50% increase in malignant compared to benign cores (p<0.0001).
20429785 stimulator of adipose tissue-derived mesenchymal stromal cells osteogenic differentiation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20376066 study suggest a shift away from canonical Wnt signaling toward noncanonical pathways driven by interactions between Wnt-5a and its cognate receptors in psoriasis, accompanied by impaired homeostatic inhibition of Wnt signaling by WIF-1 and dickkopf
20101234 Wnt5a promotes the aggressiveness of prostate cancer and that its expression is involved in relapse after prostatectomy.
20083703 Wnt5A is not involved in the onset or progression of MCC and support other data that indicate that Wnt signaling is inactive in this cancer despite its neuroendocrine origins.
20032469 WNT-5a is necessary to maintain osteogenic potential of MSC and inhibition of WNT-5a signaling therefore plays a role in their determination into preadipocytes in humans
20008136 WNT5A signaling is important in modulating tumorigenic behaviors of enamel epithelium cells in ameloblastomas.
19956879 Wnt-5a regulates proliferation in lung cancer cells
19946729 cGMP-phosphodiesterase 6 can be activated by another cancer-retina antigen, transducin, through Wnt5a-Frizzled-2 cascade, which leads to a lowering of cGMP and an increase in intracellular calcium mobilization.
19940551 Data show that tumor spheroid cells express ABCG2, Bmi1, WNT5A, CD133, prox1 and VEGFR3.
19918918 A WNT5A/ROR2 signal transduction pathway is important in craniofacial and skeletal development and proper formation and growth of these structures is sensitive to variations in WNT5A function.
19910923 Wnt5a activated Rac in the beta-catenin-independent pathway, and Frizzled2 (Fz2) and Ror1 or Ror2 were required for this action.
19878652 WNT5A negatively regulates both proliferation and migration of HDPCs, suggesting its important role in odontogenesis via controlling the HDPCs.
19874313 WNT5A, a putative tumor suppressor gene in acute myeloid leukemia (AML), is silenced by methylation in this disease and that this epigenetic event is associated with upregulation of CYCLIN D1 expression.
19849855 Differential expression of Wnt ligands in HCC cells is associated with selective activation of canonical Wnt signaling in well-differentiated, and its repression in poorly differentiated cell lines.
19802008 Data show that ROR2 knockdown results in a decrease in signaling downstream of Wnt5A.
19760930 WNT5A gene has been methylated from the early stages of colorectal cancers.
19696445 syndecan 1 and 4 correlate to increased metastatic potential in melanoma patients and are an important component of the Wnt5A autocrine signaling loop
19651774 Phospho-DARPP-32 potentiates Wnt-5a-mediated CREB activity and suppresses filopodia formation.
19582886 Laminin gamma2 mediates Wnt5a-induced invasion of gastric cancer cells.
19561643 Results indicate that Wnt5a/Ror2 signaling involves the activation of a SFK, leading to MMP-13 expression, and that constitutively active Wnt5a/Ror2 signaling confers invasive properties on osteosarcoma cells in a cell-autonomous manner.
19520808 Wnt5A is a critical mediator of CXCL12-CXCR4 signaling and migration in human and murine T
19492056 Wnt5a enhances cardiac gene expressions of EPC via an activation of PKC delta
19473452 may be an important marker during initial events of actinic cheilitis malignant transformation; might recruit other events in lip squamous cell carcinoma, such as matrix metalloproteinase 3 synthesis
19467340 Expression of Wnt-5a protein significantly stimulated cell proliferation, and transfection with siRNA plasmids suppressed Wnt-5 expression and cell proliferation
19453261 Observational study of gene-disease association. (HuGE Navigator)
19399181 Wnt5a regulates epidermal differentiation even in adult skin
19251946 WNT5A is a regulator of fibroblast proliferation and resistance to apoptosis.
19244247 Data show that Wnt-5a stimulation of breast epithelial cells leads to increased cell-cell adhesion, and that Wnt-5a/casein kinase Ialpha (CKIalpha)-specific phosphorylation of beta-catenin leads to increased complex formation of beta-catenin/E-cadherin.
19177143 Wnt5A activates calpain-1, leading to the cleavage of filamin A, which results in a remodeling of the cytoskeleton and an increase in melanoma cell motility
19171330 Mutations in the coding sequence of WNT4, WNT5A, WNT7A, and WNT9B are not responsible for the Mayer-Rokitansky-Kuster-Hauser syndrome.
19148501 pathways related to Wnt5a have an important role in ovarian malignant neoplasia.
19074888 Staining of a melanoma tissue array also highlighted the inverse relationship between MART-1 and Wnt5A expression.
19063862 Amino acid limitation in colon cancer cells induces phosphorylation of ERK1/2, which then down-regulates WNT5a expression.
19061910 These data suggest that the epigenetic remodeling of the WNT5A promoter is correlated with its transcriptional activation and this upregulation likely participates in arsenical-induced malignant transformation.
19048125 WNT5A is regulated by PAX2 and may be involved in blastemal predominant Wilms tumorigenesis
18990694 LRP1 stimulates a canonical Wnt5a signaling pathway that prevents cholesterol accumulation.
18794093 Cytoplasmic WNT5A increases with melanoma progression and strong expression is associated with poor outcome.
18703641 Expression of Wnt5a plasmid but not Wnt1 or Wnt3a increased caudal homeodomain factor CDX2 transcripts and protein in HT-29 adenocarcinoma cells. Wnt5a increased activity of a sucrase-isomaltase (SI) promoter in Caco-2BBE cells.
18656562 Data show that Wnt5a is highly expressed during osteoblastic differentiation, and that clusters of genes regulating cell cycle, cell proliferation and cell growth, and gene transcription are altered with absence of Wnt5a expression.
18632632 Wnt3a and Wnt5a have roles in inducing BMP-4 and 6 expression in prostate cancer osteoblast differentiation
18615587 both Wnt5a and Wnt3a bound Ror2, only Wnt5a induced Ror2 homo-dimerization and tyrosine phosphorylation in U2OS human osteoblastic cells.
18541964 No mutation found in Zimmermann-Laband syndrome
18477650 negative correlation between expression of Wnt-5a & hepatitis B virus x gene(HBx) mutations in hepatocellular carcinoma(HCC); it is concluded that HBx mutants may participate in development & progression of HCC, at least in part through the Wnt-5a pathway
18462958 study demonstrated that Wnt3a & Wnt5a can promote proliferation of HEK293 cells & inhibit serum starvation-induced apoptosis, which implies Wnt3a & Wnt5a can maintain survival of HEK293 cells under stress
18456733 Wnt5a expressed in atherosclerotic lesions colocalizes with TLR-4.
18420933 findings show cell-autonomous mechanisms allow Wnt5a to control cell orientation, polarity, and directional movement in response to positional cues from chemokine gradients
18413325 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18174455 Wnt5A is critically involved in inflammatory macrophage signaling in sepsis and is a target for antiinflammatory mediators like APC or antagonists like sFRP1.
18174174 MT1-MMP-induced phenotypic changes were dependent upon up-regulation of Wnt5a, which has been implicated in epithelial-to-mesenchymal transition.
18172252 WNT5A is frequently inactivated in CRC by tumor-specific methylation, and thus, is a potential biomarker.
18032022 WNT5A, a putative tumour suppressor gene in ALL, is silenced by methylation in this disease and that this epigenetic event is associated with upregulation of CYCLIN D1 expression and confers poor prognosis in patients with ALL.
17992121 These data show activation of the Wnt/beta-catenin-signalling pathway in uveal melanoma and suggest that components of this pathway might be useful prognostic markers as well as attractive therapeutic targets to treat this disease.
17986384 Our findings suggest non-canonical Wnt signalling plays a role in regulating endothelial cell growth and possibly in angiogenesis.
17967789 Wnt5a and Wnt11 expression in EPC cells was induced by coculture with rat neonatal cardiomyocyte and was blocked by gamma-secretase inhibition.
17956663 The genesis of myelocytic leukemia is related to the down-regulated expression of Wnt5a.
17952396 Review about the different influences and signaling pathways of Wnt5A in tumor progression.
17937436 did not detect submicroscopic deletion or duplication nor sequence alteration in either CACNA2D3 or WNT5A in ZLS-affected individuals
17709179 Data indicate that Wnt5a signaling is an important regulator in the proliferation of glioma cells.
17546602 These results suggest that Wnt signaling crosstalk and functional antagonism with the LRP5 co-receptor are key signaling regulators of mesenchymal stem cells maintenance and differentiation.
17525119 Ability of phenylmethimazole (C10) to decrease growth and migration of papillary thyroid cancer cells may be related to its suppressive effect on TLR3 and Wnt5a signaling.
17486081 Hypomethylation of wingless-related MMTV integration site 5A (WNT5A), S100 calcium-binding protein P (S100P) and cysteine-rich protein 1(CRIP1) was confirmed in the cancer cells by bisulfite sequencing.
17463182 Our findings demonstrate that APC status plays a key role as a determinant of Wnt5a secretion and suggest that CaSR-mediated secretion of Wnt5a will inhibit defective Wnt signaling in APC-truncated cells in an autocrine manner.
17458904 Wnt3A/5A can function as mesenchymal regulatory factors by providing instructive cues for the recruitment, maintenance, and differentiation of mesenchymal stem cells.
17426020 Wnt5A can signal via protein kinase C (PKC), so the role of PKC in Wnt5A-mediated motility and epithelial to mesenchymal transition was also assessed using PKC inhibition and activation studies
17227781 WNT5A is an important target of CUTL1 and mediator of invasiveness and tumor progression in pancreatic cancer.
17035633 Screening for Wnt5a-regulated genes in cultured endothelial cells identified several encoding angiogenic regulators, including matrix metalloproteinase-1, an interstitial collagenase, and Tie-2, a receptor for angiopoietins.
16996564 The aberrant expression of WNT5A suggest that the Wnt signaling pathway may be abnormally regulated in nasopharyngeal carcinoma (NPC), which provides insight into the molecular mechanisms of NPC.
16914445 The Embryonic Lethal Abnormal Vision-like protein HuR, inhibited translation of Wnt-5a when bound to highly conserved AU-rich sequences in the 3'-untranslated region of the Wnt-5a mRNA.
16880514 NFAT1, a transcription factor connected with breast cancer metastasis, is activated by Wnt-5a through a Ca2+ signaling pathway in human breast epithelial cells which was simultaneously counteracted by a Wnt-5a-induced Yes/Cdc42 signaling pathway.
16601243 WNT5A and FZD5 regulate the microbially induced interleukin-12 response of antigen-presenting cells and interferon-gamma production by mycobacterial antigen-stimulated T cells
16569699 The role of Wnt5A in the microenvironment of primary breast cancer and macrophage-induced breast cancer invasion.
16569699 function of Wnt 5a as either a suppressor or promoter of malignant progression seems to be modulated by intercellular interactions
16169547 Over-expression of Wnt5a in transgenic mice disrupts epithelial-response to FGF10 and regulates Shh signaling.
15735754 Wnt-5a serves as an antagonist to the canonical Wnt-signaling pathway with tumor suppressor activity in differentiated thyroid carcinomas.
15592517 Wnt-5a is involved in the response of malignant neuroblasts to retinoic acid.
15389636 Their different spatial expression patterns suggest that Wnt4 and Wnt5a proteins are not functionally linked to type II collagen and type X collagen synthesis in in vitro chondrogenic models of mesenchyme stem cells
15067324 Altered mRNA expression is associated with prostate cancer recurrence.
12841867 Down-regulation of Wnt-4 and up-regulation of Wnt-5a are possible markers of the malignant phenotype of human squamous cell carcinoma.
12805222 Results suggest that disabled-2 functions as a negative regulator of canonical Wnt signaling by stabilizing the beta-catenin degradation complex.
12482967 These results suggest that the TAK1-NLK MAPK cascade is activated by the noncanonical Wnt-5a/Ca(2+) pathway and antagonizes canonical Wnt/beta-catenin signaling.
12244165 Wnt-5a promotes T cell nuclear accumulation of the transcription factor NFAT in the presence of cyclosporin A.
12165812 WNT5a is upregulated by TNF-alpha in tumor cell lines
12086864 Increased expression of WNT5a is associated with cell motility and invasion of metastatic melanoma
11956659 Frequent up-regulation of WNT5A mRNA in primary gastric cancer.

AA Sequence

MKKSIGILSPGVALGMAGSAMSSKFFLVALAIFFSFAQVVIEANSWWSLGMNNPVQMSEVYIIGAQPLCS      1 - 70
QLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYA     71 - 140
VSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGS    141 - 210
YESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNS    211 - 280
RGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTV    281 - 350
QTERCHCKFHWCCYVKCKKCTEIVDQFVCK                                            351 - 380
//

Text Mined References (267)

PMID Year Title
26997628 2016 Aberrant nonfibrotic parenchyma in idiopathic pulmonary fibrosis is correlated with decreased ?-catenin inhibition and increased Wnt5a/b interaction.
26978652 2016 Inactivation of the WNT5A Alternative Promoter B Is Associated with DNA Methylation and Histone Modification in Osteosarcoma Cell Lines U2OS and SaOS-2.
26848991 2016 Dysfunction of WNT4/WNT5A in deciduas: possible relevance to the pathogenesis of preeclampsia.
26800561 2016 Endothelial Dysfunction in Human Diabetes Is Mediated by Wnt5a-JNK Signaling.
26794322 2016 Wnt5a Deficiency Leads to Anomalies in Ureteric Tree Development, Tubular Epithelial Cell Organization and Basement Membrane Integrity Pointing to a Role in Kidney Collecting Duct Patterning.
26708384 2016 Wnt5a-Ror2 signaling in mesenchymal stem cells promotes proliferation of gastric cancer cells by activating CXCL16-CXCR6 axis.
26708300 2016 MicroRNA-154 functions as a tumor suppressor in osteosarcoma by targeting Wnt5a.
26690702 2016 Wnt5a induces ROR1/ROR2 heterooligomerization to enhance leukemia chemotaxis and proliferation.
26648282 2016 Upregulation of the expression of Wnt5a promotes the proliferation of pancreatic cancer cells in vitro and in a nude mouse model.
26596412 2015 Wnt5a, Ryk and Ror2 expression in glioblastoma subgroups.
26558991 2015 Immunohistochemical expression of WNT5A and MMPs in odontogenic epithelial tumors and cysts.
26538547 2016 Expression of WNT5A in Idiopathic Pulmonary Fibrosis and Its Control by TGF-? and WNT7B in Human Lung Fibroblasts.
26514730 2016 WNT-5A: signaling and functions in health and disease.
26511503 2015 High levels of WNT-5A in human glioma correlate with increased presence of tumor-associated microglia/monocytes.
26462870 2016 Wnt5A exerts immunomodulatory activity in the human ovarian cancer cell line SKOV-3.
26342861 2015 Wnts grasp the WIF domain of Wnt Inhibitory Factor 1 at two distinct binding sites.
26305508 2015 Over-expression of ROR2 and Wnt5a cooperatively correlates with unfavorable prognosis in patients with non-small cell lung cancer.
26281688 2015 [Novel signal transduction pathways: the molecular basis for targeted cancer therapies in Hedgehog/Notch/Wnt pathway].
26278011 2015 Variants in the Regulatory Region of WNT5A Reduced Risk of Cardiac Conotruncal Malformations in the Chinese Population.
26240275 2016 Autocrine Signaling by Wnt-5a Deregulates Chemotaxis of Leukemic Cells and Predicts Clinical Outcome in Chronic Lymphocytic Leukemia.
26202350 2015 Wnt/?-Catenin and Wnt5a/Ca Pathways Regulate Proliferation and Apoptosis of Keratinocytes in Psoriasis Lesions.
26118187 2015 Wnt5a Promotes Cytokines Production and Cell Proliferation in Human Hepatic Stellate Cells Independent of Canonical Wnt Pathway.
26054690 2015 miR-217 targeting Wnt5a in osteosarcoma functions as a potential tumor suppressor.
25944911 2015 Protein Depalmitoylation Is Induced by Wnt5a and Promotes Polarized Cell Behavior.
25913759 2015 Decreased DNA methylation in the promoter region of the WNT5A and GDNF genes may promote the osteogenicity of mesenchymal stem cells from patients with ossified spinal ligaments.
25823923 2015 WNT5A promotes stemness characteristics in nasopharyngeal carcinoma cells leading to metastasis and tumorigenesis.
25779663 2015 EGF-reduced Wnt5a transcription induces epithelial-mesenchymal transition via Arf6-ERK signaling in gastric cancer cells.
25772239 2016 WIF1 re-expression in glioblastoma inhibits migration through attenuation of non-canonical WNT signaling by downregulating the lncRNA MALAT1.
25769722 2015 Paracrine WNT5A Signaling Inhibits Expansion of Tumor-Initiating Cells.
25655430 2015 Wnt5a Induces Collagen Production by Human Periodontal Ligament Cells Through TGF?1-Mediated Upregulation of Periostin Expression.
25622531 2015 Wnt5a promotes cancer cell invasion and proliferation by receptor-mediated endocytosis-dependent and -independent mechanisms, respectively.
25619716 2015 Insight into the role of Wnt5a-induced signaling in normal and cancer cells.
25454492 2014 Human placenta-derived Wnt-5a induces the expression of ICAM-1 and VCAM-1 in CD133(+)CD34(+)-hematopoietic progenitor cells.
25450290 2014 Wnt5a/Ca (2+) /calcineurin/nuclear factor of activated T signaling pathway as a potential marker of pediatric melanoma.
25413872 2015 Serum wnt5a is a predictor for the prognosis of acute on chronic hepatitis B liver failure.
25410163 2016 HNF4? is a therapeutic target that links AMPK to WNT signalling in early-stage gastric cancer.
25407936 2015 Wnt5A promotes an adaptive, senescent-like stress response, while continuing to drive invasion in melanoma cells.
25401518 2014 Wnt5A regulates ABCB1 expression in multidrug-resistant cancer cells through activation of the non-canonical PKA/?-catenin pathway.
25382802 2015 The wingless-related integration site-5a/secreted frizzled-related protein-5 system is dysregulated in human sepsis.
25337253 2014 Wnt5A expression is associated with the tumor metastasis and clinical survival in cervical cancer.
25308364 2014 WNT5A modulates cell cycle progression and contributes to the chemoresistance in pancreatic cancer cells.
25303486 2015 Up-regulated expression of WNT5a increases inflammation and oxidative stress via PI3K/AKT/NF-?B signaling in the granulosa cells of PCOS patients.
25240110 2014 Wnt5a: a player in the pathogenesis of atherosclerosis and other inflammatory disorders.
25240054 2014 Monocyte-secreted Wnt5a interacts with FZD5 in microvascular endothelial cells and induces angiogenesis through tissue factor signaling.
25224731 2015 WNT5A has anti-prostate cancer effects in vitro and reduces tumor growth in the skeleton in vivo.
25204426 2014 Stage of breast cancer progression influences cellular response to activation of the WNT/planar cell polarity pathway.
25196330 2014 Wnt5a signaling increases IL-12 secretion by human dendritic cells and enhances IFN-? production by CD4+ T cells.
25107489 2014 Promoter methylation analysis of WNT/?-catenin pathway regulators and its association with expression of DNMT1 enzyme in colorectal cancer.
25031739 2014 Expression of Wnt-5a and ?-catenin in primary hepatocellular carcinoma.
25022753 2014 Interleukin-1?-induced Wnt5a enhances human corneal endothelial cell migration through regulation of Cdc42 and RhoA.
24999479 2014 Overexpression of Wnt5a promotes angiogenesis in NSCLC.
24993819 2014 IL-1? mediates MCP-1 induction by Wnt5a in gastric cancer cells.
24972966 2014 MiR-26a inhibits prostate cancer progression by repression of Wnt5a.
24898696 2014 Wnt5a promotes vasculogenic mimicry and epithelial-mesenchymal transition via protein kinase C? in epithelial ovarian cancer.
24891513 2014 Wnt5a promotes inflammatory responses via nuclear factor ?B (NF-?B) and mitogen-activated protein kinase (MAPK) pathways in human dental pulp cells.
24865425 2014 WNT5A enhances resistance of melanoma cells to targeted BRAF inhibitors.
24840810 2014 Activation of noncanonical Wnt signaling through WNT5A in visceral adipose tissue of obese subjects is related to inflammation.
24833087 2014 Downregulation of WIF-1 and Wnt5a in patients with colorectal carcinoma: clinical significance.
24796738 2014 [Preparation of the recombinant lentiviral expression vector targeting human Wnt5a gene and its inhibitory effect on melanoma cell invasion].
24766647 2014 WNT5A induces release of exosomes containing pro-angiogenic and immunosuppressive factors from malignant melanoma cells.
24750404 2014 Wnt5a: a potential factor linking psoriasis to metabolic complications.
24716670 2015 De novo WNT5A-associated autosomal dominant Robinow syndrome suggests specificity of genotype and phenotype.
24706725 2014 Wnt5a-Rac1-NF-?B homeostatic circuitry sustains innate immune functions in macrophages.
24696716 2014 Wnt5a involved in regulation of the biological behavior of hepatocellular carcinoma.
24658506 2014 Wnt5a/?-catenin signaling drives calcium-induced differentiation of human primary keratinocytes.
24647585 2014 Expression patterns of WNT/?-CATENIN signaling molecules during human tooth development.
24626628 2014 Oncogenic effects of WNT5A in Epstein-Barr virus?associated nasopharyngeal carcinoma.
24621529 2014 Ryk is essential for Wnt-5a-dependent invasiveness in human glioma.
24606488 2014 Differential Wnt11 expression related to Wnt5a in high- and low-grade serous ovarian cancer: implications for migration, adhesion and survival.
24603290 2014 Balanced duo of anti-inflammatory SFRP5 and proinflammatory WNT5A in children.
24518599 2014 Prostate cancer bone metastases acquire resistance to androgen deprivation via WNT5A-mediated BMP-6 induction.
24464650 2014 Wnt5a suppresses colon cancer by inhibiting cell proliferation and epithelial-mesenchymal transition.
24449494 2014 Dysfunction of Wnt signaling and synaptic disassembly in neurodegenerative diseases.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24416340 2014 GEC-derived SFRP5 inhibits Wnt5a-induced macrophage chemotaxis and activation.
24399733 2013 Inhibition of Wnt/?-catenin signaling mediates ursolic acid-induced apoptosis in PC-3 prostate cancer cells.
24395444 2014 The roles of Wnt5a, JNK and paxillin in the occurrence of metastasis of pancreatic adenocarcinoma.
24346691 2014 The Wnt/planar cell polarity signaling pathway contributes to the integrity of tight junctions in brain endothelial cells.
24346141 2014 Wnt5a, TLR2 and TLR4 are elevated in advanced human atherosclerotic lesions.
24335906 2013 Wnt5a uses CD146 as a receptor to regulate cell motility and convergent extension.
24293407 2014 WNT5A-mediated ?-catenin-independent signalling is a novel regulator of cancer cell metabolism.
24260410 2013 WNT5A encodes two isoforms with distinct functions in cancers.
24185202 2013 Induction and transport of Wnt 5a during macrophage-induced malignant invasion is mediated by two types of extracellular vesicles.
24156409 2013 Upregulation of Wnt5a promotes epithelial-to-mesenchymal transition and metastasis of pancreatic cancer cells.
24139281 2014 PGRN haploinsufficiency increased Wnt5a signaling in peripheral cells from frontotemporal lobar degeneration-progranulin mutation carriers.
24091015 2013 Wnt5a directs polarized calcium gradients by recruiting cortical endoplasmic reticulum to the cell trailing edge.
23963164 2013 Dexamethasone induces cross-linked actin networks in trabecular meshwork cells through noncanonical wnt signaling.
23947922 2013 Correlation of Wnt5a expression with histopathological grade/stage in urothelial carcinoma of the bladder.
23764752 2013 Wnt5a promotes human colon cancer cell migration and invasion but does not augment intestinal tumorigenesis in Apc1638N mice.
23748645 2014 Immunoreactivity of Wnt5a, Fzd2, Fzd6, and Ryk in glioblastoma: evaluative methodology for DAB chromogenic immunostaining.
23716599 2013 SWI/SNF chromatin-remodeling factor Smarcd3/Baf60c controls epithelial-mesenchymal transition by inducing Wnt5a signaling.
23679576 2013 Wnt5a inhibits human monocyte-derived myeloid dendritic cell generation.
23660959 2013 Adult T-cell leukemia cells overexpress Wnt5a and promote osteoclast differentiation.
23653377 2013 Circulating secreted frizzled-related protein 5 (Sfrp5) and wingless-type MMTV integration site family member 5a (Wnt5a) levels in patients with type 2 diabetes mellitus.
23615002 2013 WNT5A is a key regulator of the epithelial-mesenchymal transition and cancer stem cell properties in human gastric carcinoma cells.
23484019 2013 WNT5A inhibits metastasis and alters splicing of Cd44 in breast cancer cells.
23469623 2013 ROR2 and Wnt5a expression in stage 1 pure testicular seminomas.
23462101 2013 The small GTPase ARF6 stimulates ?-catenin transcriptional activity during WNT5A-mediated melanoma invasion and metastasis.
23417837 2013 Loss of WIF-1 and Wnt5a expression is related to aggressiveness of sporadic breast cancer in Tunisian patients.
23396967 2013 Functional consequences of Wnt-induced dishevelled 2 phosphorylation in canonical and noncanonical Wnt signaling.
23359789 2013 WNT5A-NFAT signaling mediates resistance to apoptosis in pancreatic cancer.
23353182 2013 Rab35 is required for Wnt5a/Dvl2-induced Rac1 activation and cell migration in MCF-7 breast cancer cells.
23349696 2013 Wnt5a is associated with cigarette smoke-related lung carcinogenesis via protein kinase C.
23342259 2012 Emphasizing the role of Wnt5a protein expression to predict favorable outcome after radical prostatectomy in patients with low-grade prostate cancer.
23278988 2013 Prognostic significance of Ror2 and Wnt5a expression in medulloblastoma.
23271023 2012 Expression pattern of PRM2, HSP90 and WNT5A in male partners of couples experiencing idiopathic recurrent miscarriages.
23266365 2013 Autocrine stimulation of osteoblast activity by Wnt5a in response to TNF-? in human mesenchymal stem cells.
23265959 2013 Lack of association of WNT5A mutations with Müllerian duct abnormalities.
23254341 2013 Noncanonical WNT-5A signaling regulates TGF-?-induced extracellular matrix production by airway smooth muscle cells.
23178630 Methylation of the WNT5A gene is frequently detected in early gastric carcinoma.
23159080 2012 [Expression of Wnt5a, APC, ?-catenin and their clinical significance in human colorectal adenocarcinoma].
23075330 2012 Wnt5a promotes ewing sarcoma cell migration through upregulating CXCR4 expression.
23054609 2013 SFRP5 inhibits gastric epithelial cell migration induced by macrophage-derived Wnt5a.
23046419 2012 Differential regulation of the mouse and human Wnt5a alternative promoters A and B.
23001722 2013 Epigenetic silencing of WNT5A in Epstein-Barr virus-associated gastric carcinoma.
22988876 2012 The importance of Wnt signalling for neurodegeneration in Parkinson's disease.
22825874 2012 Wnt5a signaling controls cytokinesis by correctly positioning ESCRT-III at the midbody.
22781592 2013 Myeloma cells inhibit non-canonical wnt co-receptor ror2 expression in human bone marrow osteoprogenitor cells: effect of wnt5a/ror2 pathway activation on the osteogenic differentiation impairment induced by myeloma cells.
22694338 2012 Proteomic analysis of extracellular matrix from the hepatic stellate cell line LX-2 identifies CYR61 and Wnt-5a as novel constituents of fibrotic liver.
22655072 2012 Dvl2-dependent activation of Daam1 and RhoA regulates Wnt5a-induced breast cancer cell migration.
22609948 2012 Identification of a novel Wnt5a-CK1?-Dvl2-Plk1-mediated primary cilia disassembly pathway.
22547701 2012 Wnt5a induces a tolerogenic phenotype of macrophages in sepsis and breast cancer patients.
22493546 2012 Loss of Wnt5a and Ror2 protein in hepatocellular carcinoma associated with poor prognosis.
22485170 2012 Modulation of Wnt5a expression by periodontopathic bacteria.
22384249 2012 Pro-inflammatory wnt5a and anti-inflammatory sFRP5 are differentially regulated by nutritional factors in obese human subjects.
22384081 2012 Wnt5a is strongly expressed at the leading edge in non-melanoma skin cancer, forming active gradients, while canonical Wnt signalling is repressed.
22293903 2012 Expression of WNT-5a and ROR2 correlates with disease severity in osteosarcoma.
22162112 2012 WNT5A is induced by inflammatory mediators in bone marrow stromal cells and regulates cytokine and chemokine production.
22128168 2012 Dissection of Wnt5a-Ror2 signaling leading to matrix metalloproteinase (MMP-13) expression.
22124122 2012 Wnt5a is secreted by follicular dendritic cells to protect germinal center B cells via Wnt/Ca2+/NFAT/NF-?B-B cell lymphoma 6 signaling.
22101459 2012 An anti-Wnt5a antibody suppresses metastasis of gastric cancer cells in vivo by inhibiting receptor-mediated endocytosis.
22039506 2011 Elevated level of Wnt5a protein in localized prostate cancer tissue is associated with better outcome.
21980498 2011 Mesodermal progenitor cells (MPCs) differentiate into mesenchymal stromal cells (MSCs) by activation of Wnt5/calmodulin signalling pathway.
21918189 2011 Wnt5a skews dendritic cell differentiation to an unconventional phenotype with tolerogenic features.
21871017 2011 NFAT promotes carcinoma invasive migration through glypican-6.
21816908 2011 Wnt5a suppresses epithelial ovarian cancer by promoting cellular senescence.
21672426 2011 [Expression of Wnt5a in the terminal rectum of children with anorectal malformation].
21587258 2011 Promoter methylation of Wnt5a is associated with microsatellite instability and BRAF V600E mutation in two large populations of colorectal cancer patients.
21461571 Effects of Wnt5a protein on proliferation and apoptosis in JAR choriocarcinoma cells.
21431850 2011 Spatiotemporal expression of Wnt5a during the development of the hindgut and anorectum in human embryos.
21365928 2010 [Up-regulation of Wnt5A in chronic rhinosinusitis with nasal polyps].
21352264 2011 Loss of Wnt-5? is associated with an invasive phenotype of extramammary Paget's disease.
21344486 2011 Expression profile of WNT molecules in prostate cancer and its regulation by aminobisphosphonates.
21342370 2011 Critical role of Wnt5a-Ror2 signaling in motility and invasiveness of carcinoma cells following Snail-mediated epithelial-mesenchymal transition.
21285942 2011 Adipose tissue macrophages inhibit adipogenesis of mesenchymal precursor cells via wnt-5a in humans.
21270611 2011 Wnt5a as a predictor in poor clinical outcome of patients and a mediator in chemoresistance of ovarian cancer.
21209903 2010 Gene expression profiling reveals new aspects of PIK3CA mutation in ERalpha-positive breast cancer: major implication of the Wnt signaling pathway.
21205070 2011 Wnt-5a signaling is correlated with infiltrative activity in human glioma by inducing cellular migration and MMP-2.
21165581 2011 WNT5A expression is regulated by the status of its promoter methylation in leukaemia and can inhibit leukemic cell malignant proliferation.
21115903 2010 Genistein increases gene expression by demethylation of WNT5a promoter in colon cancer cell line SW1116.
21069266 2011 The Wnt5a/Ror2 noncanonical signaling pathway inhibits canonical Wnt signaling in K562 cells.
20955350 2011 Loss of Klotho during melanoma progression leads to increased filamin cleavage, increased Wnt5A expression, and enhanced melanoma cell motility.
20890934 2010 Studies with Wnt genes and nonsyndromic cleft lip and palate.
20639201 2010 Non-canonical Wnt signaling induces ubiquitination and degradation of Syndecan4.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20603606 2010 WNT5A antagonizes WNT/?-catenin signaling and is frequently silenced by promoter CpG methylation in esophageal squamous cell carcinoma.
20554957 2010 Wnt5a induces endothelial inflammation via beta-catenin-independent signaling.
20525402 2010 Analysis of eight genes modulating interferon gamma and human genetic susceptibility to tuberculosis: a case-control association study.
20518933 2010 Wnt5a promotes differentiation of human dental papilla cells.
20454608 2010 A novel role for Wnt/Ca2+ signaling in actin cytoskeleton remodeling and cell motility in prostate cancer.
20429785 2010 WNT5A induces osteogenic differentiation of human adipose stem cells via rho-associated kinase ROCK.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20376066 2010 Evidence for altered Wnt signaling in psoriatic skin.
20101234 2010 Wnt5a signaling is involved in the aggressiveness of prostate cancer and expression of metalloproteinase.
20083703 2010 Lack of Wnt5A expression in Merkel cell carcinoma.
20034610 2010 Expression of Wnt5a in tooth germs and the related signal transduction analysis.
20032469 2010 Role of WNT-5a in the determination of human mesenchymal stem cells into preadipocytes.
20008136 2010 WNT5A expression in ameloblastoma and its roles in regulating enamel epithelium tumorigenic behaviors.
19956879 2010 Wnt-5a regulates proliferation in lung cancer cells.
19946729 2010 cGMP-phosphodiesterase 6, transducin and Wnt5a/Frizzled-2-signaling control cGMP and Ca(2+) homeostasis in melanoma cells.
19940551 2009 Isolation and characterization of spheroid cells from human malignant melanoma cell line WM-266-4.
19918918 2010 WNT5A mutations in patients with autosomal dominant Robinow syndrome.
19910923 2010 Wnt5a regulates distinct signalling pathways by binding to Frizzled2.
19878652 2009 WNT5A inhibits human dental papilla cell proliferation and migration.
19874313 2010 Epigenetic regulation of the non-canonical Wnt pathway in acute myeloid leukemia.
19849855 2009 Canonical Wnt signaling is antagonized by noncanonical Wnt5a in hepatocellular carcinoma cells.
19847889 2010 SUZ12 is a candidate target of the non-canonical WNT pathway in the progression of chronic myeloid leukemia.
19802008 2010 The orphan tyrosine kinase receptor, ROR2, mediates Wnt5A signaling in metastatic melanoma.
19760930 WNT5A gene is aberrantly methylated from the early stages of colorectal cancers.
19696445 2009 Heparan sulfate proteoglycan modulation of Wnt5A signal transduction in metastatic melanoma cells.
19651774 2009 Wnt-5a-induced phosphorylation of DARPP-32 inhibits breast cancer cell migration in a CREB-dependent manner.
19582886 2009 Laminin gamma2 mediates Wnt5a-induced invasion of gastric cancer cells.
19561643 2009 Autonomous regulation of osteosarcoma cell invasiveness by Wnt5a/Ror2 signaling.
19520808 2009 Activation of Wnt5A signaling is required for CXC chemokine ligand 12-mediated T-cell migration.
19492056 2009 Wnt5a increases cardiac gene expressions of cultured human circulating progenitor cells via a PKC delta activation.
19473452 2009 WNT-5A, but not matrix metalloproteinase 3 or beta-catenin protein, expression is related to early stages of lip carcinogenesis.
19467340 2009 Construction of human Wnt-5a sense gene and RNAi eukaryotic expression vector.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19399181 2009 Wnt5a exhibits layer-specific expression in adult skin, is upregulated in psoriasis, and synergizes with type 1 interferon.
19277043 2009 Secreted Frizzled-related protein-1 is a negative regulator of androgen receptor activity in prostate cancer.
19251946 2009 WNT5A is a regulator of fibroblast proliferation and resistance to apoptosis.
19244247 2009 Wnt-5a-CKI{alpha} signaling promotes {beta}-catenin/E-cadherin complex formation and intercellular adhesion in human breast epithelial cells.
19177143 2009 Wnt5A activates the calpain-mediated cleavage of filamin A.
19171330 2009 Mutational analysis of the WNT gene family in women with Mayer-Rokitansky-Kuster-Hauser syndrome.
19148501 2009 Canonical and noncanonical Wnt pathway: a comparison among normal ovary, benign ovarian tumor and ovarian cancer.
19099253 2008 Detecting PKC phosphorylation as part of the Wnt/calcium pathway in cutaneous melanoma.
19074888 2008 Wnt5A regulates expression of tumor-associated antigens in melanoma via changes in signal transducers and activators of transcription 3 phosphorylation.
19063862 2009 Amino acid limitation induces down-regulation of WNT5a at transcriptional level.
19061910 2009 Epigenetic mediated transcriptional activation of WNT5A participates in arsenical-associated malignant transformation.
19048125 2008 WNT5A is regulated by PAX2 and may be involved in blastemal predominant Wilms tumorigenesis.
18990694 2009 LRP1 controls intracellular cholesterol storage and fatty acid synthesis through modulation of Wnt signaling.
18794093 2008 WNT5A expression increases during melanoma progression and correlates with outcome.
18703641 2008 CaSR stimulates secretion of Wnt5a from colonic myofibroblasts to stimulate CDX2 and sucrase-isomaltase using Ror2 on intestinal epithelia.
18656562 2008 Dissection of sets of genes that control the character of wnt5a-deficient mouse calvarial cells.
18632632 2008 Prostate cancer induces bone metastasis through Wnt-induced bone morphogenetic protein-dependent and independent mechanisms.
18615587 2008 Wnt5a induces homodimerization and activation of Ror2 receptor tyrosine kinase.
18541964 2008 No mutation in genes of the WNT signaling pathway in patients with Zimmermann-Laband syndrome.
18477650 2008 Mutations in the C-terminus of the X protein of hepatitis B virus regulate Wnt-5a expression in hepatoma Huh7 cells: cDNA microarray and proteomic analyses.
18462958 2008 Effects of Wnt proteins on cell proliferation and apoptosis in HEK293 cells.
18456733 2008 Wnt5a is expressed in murine and human atherosclerotic lesions.
18420933 2008 Wnt5a control of cell polarity and directional movement by polarized redistribution of adhesion receptors.
18413325 2008 Variation in WNT genes is associated with non-syndromic cleft lip with or without cleft palate.
18287027 2008 Antisera induced by infusions of autologous Ad-CD154-leukemia B cells identify ROR1 as an oncofetal antigen and receptor for Wnt5a.
18174455 2008 Wnt5A/CaMKII signaling contributes to the inflammatory response of macrophages and is a target for the antiinflammatory action of activated protein C and interleukin-10.
18174174 2008 Membrane type 1 matrix metalloproteinase induces epithelial-to-mesenchymal transition in prostate cancer.
18172252 2008 WNT5A exhibits tumor-suppressive activity through antagonizing the Wnt/beta-catenin signaling, and is frequently methylated in colorectal cancer.
18032022 2007 WNT5A, a putative tumour suppressor of lymphoid malignancies, is inactivated by aberrant methylation in acute lymphoblastic leukaemia.
17992121 2007 Expression of Wnt5a and its downstream effector beta-catenin in uveal melanoma.
17986384 2008 Wnt5a-mediated non-canonical Wnt signalling regulates human endothelial cell proliferation and migration.
17976063 2007 Effects of grade of oocyte-cumulus complex and the interactions between grades on the production of blastocysts in the cow, ewe and lamb.
17967789 2007 Notch signaling contributes to the expression of cardiac markers in human circulating progenitor cells.
17956663 2007 [Expression of wnt5a gene in hematologic diseases and leukemic cell lines].
17952396 2008 The complex pathways of Wnt 5a in cancer progression.
17937436 2007 Extensive molecular genetic analysis of the 3p14.3 region in patients with Zimmermann-Laband syndrome.
17848411 2007 Developmental changes in human fetal testicular cell numbers and messenger ribonucleic acid levels during the second trimester.
17709179 2007 Role of Wnt5a in the proliferation of human glioblastoma cells.
17546602 2007 Cross-talk between Wnt signaling pathways in human mesenchymal stem cells leads to functional antagonism during osteogenic differentiation.
17525119 2007 High basal levels of functional toll-like receptor 3 (TLR3) and noncanonical Wnt5a are expressed in papillary thyroid cancer and are coordinately decreased by phenylmethimazole together with cell proliferation and migration.
17486081 2007 Hypomethylation of WNT5A, CRIP1 and S100P in prostate cancer.
17463182 2007 Wnt5a secretion stimulated by the extracellular calcium-sensing receptor inhibits defective Wnt signaling in colon cancer cells.
17458904 2007 Canonical and non-canonical Wnts differentially affect the development potential of primary isolate of human bone marrow mesenchymal stem cells.
17426020 2007 The Wnt5A/protein kinase C pathway mediates motility in melanoma cells via the inhibition of metastasis suppressors and initiation of an epithelial to mesenchymal transition.
17227781 2007 WNT5A--target of CUTL1 and potent modulator of tumor cell migration and invasion in pancreatic cancer.
17035633 2006 Wnt5a signaling induces proliferation and survival of endothelial cells in vitro and expression of MMP-1 and Tie-2.
16996564 2007 Gene expression profiling of nasopharyngeal carcinoma reveals the abnormally regulated Wnt signaling pathway.
16914445 2006 Wnt-5a mRNA translation is suppressed by the Elav-like protein HuR in human breast epithelial cells.
16880514 2006 Wnt-5a/Ca2+-induced NFAT activity is counteracted by Wnt-5a/Yes-Cdc42-casein kinase 1alpha signaling in human mammary epithelial cells.
16601243 2006 The Wingless homolog WNT5A and its receptor Frizzled-5 regulate inflammatory responses of human mononuclear cells induced by microbial stimulation.
16569699 2006 Wnt 5a signaling is critical for macrophage-induced invasion of breast cancer cell lines.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16258938 2006 Expression patterns of Wnt genes during development of an anterior part of the chicken eye.
16169547 2005 Wnt5a regulates Shh and Fgf10 signaling during lung development.
15735754 2005 Wnt-5a has tumor suppressor activity in thyroid carcinoma.
15592517 2005 Low expression of Wnt-5a gene is associated with high-risk neuroblastoma.
15588944 2004 Wnt3 modulates the characteristics and cobblestone area-supporting activity of human stromal cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15389636 2005 Sustained Wnt protein expression in chondral constructs from mesenchymal stem cells.
15067324 2004 Gene expression profiling predicts clinical outcome of prostate cancer.
15040835 2004 Cooperation between TGF-beta and Wnt pathways during chondrocyte and adipocyte differentiation of human marrow stromal cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12952940 2003 Wnt-5a inhibits the canonical Wnt pathway by promoting GSK-3-independent beta-catenin degradation.
12841867 2003 Down-regulation of Wnt-4 and up-regulation of Wnt-5a expression by epithelial-mesenchymal transition in human squamous carcinoma cells.
12805222 2003 Regulation of the Wnt signaling pathway by disabled-2 (Dab2).
12482967 2003 The TAK1-NLK mitogen-activated protein kinase cascade functions in the Wnt-5a/Ca(2+) pathway to antagonize Wnt/beta-catenin signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12244165 2002 Endothelial cells stimulate T cell NFAT nuclear translocation in the presence of cyclosporin A: involvement of the wnt/glycogen synthase kinase-3 beta pathway.
12165812 2002 Expression and regulation of WNT5A and WNT5B in human cancer: up-regulation of WNT5A by TNFalpha in MKN45 cells and up-regulation of WNT5B by beta-estradiol in MCF-7 cells.
11956659 2002 Frequent up-regulation of WNT5A mRNA in primary gastric cancer.
10557084 1999 Human frizzled 1 interacts with transforming Wnts to transduce a TCF dependent transcriptional response.
10491302 1999 Identification of a Wnt-responsive signal transduction pathway in primary endothelial cells.
9787155 1998 Role of members of the Wnt gene family in human hematopoiesis.
9054360 1997 A member of the Frizzled protein family mediating axis induction by Wnt-5A.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8537388 1995 Characterization of the complete genomic structure of the human WNT-5A gene, functional analysis of its promoter, chromosomal mapping, and expression in early human embryogenesis.
8288227 1993 Molecular cloning of the human proto-oncogene Wnt-5A and mapping of the gene (WNT5A) to chromosome 3p14-p21.
8167409 1993 Wnt family proteins are secreted and associated with the cell surface.