Property Summary

NCBI Gene PubMed Count 88
PubMed Score 227.80
PubTator Score 124.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (9)

Disease log2 FC p
ovarian cancer -1.800 5.8e-07
Barrett's esophagus -1.100 5.0e-02
cutaneous lupus erythematosus -1.200 3.3e-02
cystic fibrosis 1.100 2.5e-04
esophageal adenocarcinoma -1.600 2.6e-02
fibroadenoma 1.900 1.4e-02
inflammatory breast cancer -1.600 2.5e-02
lung carcinoma 3.300 4.3e-51
psoriasis 1.700 7.6e-04

Gene RIF (58)

AA Sequence

MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRG      1 - 70
AQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDR     71 - 140
TVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHG    141 - 210
VSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFC    211 - 280
EQDMRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTC    281 - 350
R//

Text Mined References (88)

PMID Year Title