Property Summary

NCBI Gene PubMed Count 141
PubMed Score 428.84
PubTator Score 287.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Reperfusion Injury 84
Disease Target Count P-value
lung adenocarcinoma 2714 5.4e-10
Disease Target Count
Osteoporosis, Juvenile 4

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.500 5.4e-10

Gene RIF (111)

PMID Text
27138857 The pool of ADP-ribosylated Axin, which is degraded under basal conditions, increases immediately following Wnt stimulation in both Drosophila and human cells.
26643293 The results reveal a novel inhibitory role of Wnt3a on canonical Wnt/beta-catenin signaling and cancer cell proliferation when there is an insufficient blood supply during tumor development.
26266404 Upregulated Wnt3a in colon cancer cells promoted the capacity to form tube-like structures in the three-dimensional (3-D) culture together with increased expression of endothelial phenotype-associated proteins such as VEGFR2 and VE-cadherin.
25848952 72 Wnt target genes higher expressed in triple-negative breast cancer
25805505 Wnt3a can modulate intracellular localisation and secretion of sFRP4.
25656539 Wnt-mediated protein stabilization ensures proper mitotic microtubule assembly and chromosome segregation.
25651906 These observations demonstrated the first time that Wnt3a can directly activate MyoD expression through targeting cis-elements in the DE and the L fragment.
25572698 Wnt3a and Notch3 may promote the metastasis of non-small cell lung cancer and Notch3 upregulation is required for the Wnt3a mediated increased metastatic abilities of non-small cell lung cancer.
25556760 a Wnt-amplified environment was associated with superior pulp healing.
25499541 Wnt3a expression was associated with epithelial mesenchymal transition and promoted colon cancer progression.
25425204 The interaction between Wnt isoforms and their LRP6 cognate receptor depends on the jutting loop present in Wnt3a but absent in Wnt5b.
25359619 High WNT3A expression is associated with bone destruction in lung and breast cancer.
25301448 High WNT3A expression is associated with glioblastoma.
25174704 miR-195 is key in regulating cell proliferation, cell cycle and apoptosis through targeting Wnt3a.
25147340 p66(Shc) plays a vital part in canonical Wnt signaling in the endothelium and mediates Wnt3a-stimulated endothelial oxidative stress and dysfunction.
25143377 The LRP6 tyrosine mutant increased in signaling activation in response to Wnt3a/beta-catenin stimulation.
24991956 Wnt3a recruits the Wnt-calcium signaling pathway in peripheral nerves in a pain model.
24841207 Mutation of any individual cysteine of Wnt3a results in covalent Wnt oligomers through ectopic intermolecular disulfide bond formation and diminishes/abolishes Wnt signaling.
24817932 WNT3A gene expression is associated with isolated Hirschsprung disease polymorphism and disease status.
24686518 Application of recombinant Wnt3a showed an anti-proliferative effect on keratinocytes in a dose-dependent manner.
24584697 SNP rs752107 in WNT3A was strongly associated with decreased total hip BMD showing the highest significance under the recessive model
24564183 Wnt3a expression is high in the tumor environment; the protein is found in over 50% of primary tumors, but the prevalence is lower in tissue from colorectal cancer metastatic sites.
24510127 these results show that TAZ mediates Wnt3a-stimulated osteogenic differentiation through PP1A, suggesting that the Wnt signal regulates the Hippo pathway.
24346024 Negative modulation of cilia assembly and trafficking by IFT88 siRNA increases canonical wnt signaling in response to wnt3a.
24340027 results demonstrate that, while ER signaling acts synergistically with Wnt3A in promoting osteogenic differentiation, Wnt3A may crosstalk with ER signaling by up-regulating ERalpha expression and down-regulating ERbeta expression in MPCs.
24321072 Wnt3a inhibited the apoptosis of mouse embryonic liver stem cells
24265322 Data show that beta-arrestins regulate Wnt3a-induced low density lipoprotein receptor-related protein 6 (Lrp6) phosphorylation by the regulation of the membrane dynamics of Amer1.
24209998 High Wnt3A expression is associated with metastasis in triple negative breast cancer.
24052942 WNT3A alone was a poor inducer of mesoderm from hESCs in defined medium. WNT3A and BMP4 synergized to accelerate mesoderm formation. Added later, WNT3A blocked hematopoiesis and generated mesenchymal colonies.
23999248 Data suggest that activation of Wnt signaling pathway in rhabdomyosarcoma via Wnt3a involves reduced phosphorylation of CTNNB1 (catenin beta-1), stabilization of active cytosolic CTNNB1, and nuclear translocation of CTNNB1.
23954131 The activation of effector T cells increased Wnt3a production, and Wnt3a levels were found to be greatly increased in mononuclear cells isolated from synovial fluid versus peripheral blood of arthritis patients.
23893409 a new role for Ror2 in conveying a tonic signal to stabilize soluble beta-catenin and create a poised state of enhanced responsiveness to Wnt3a exogenous signals in RCC.
23559372 Paracrine Wnt signaling both promotes and inhibits human breast tumor growth.
23509994 In ankylosing spondylitis patients, Wnt-3a serum levels are lower in the high activity group compared to low activity group and controls.
23396968 site-specific Dvl2 phosphorylation is required for Dvl2 association with PKCiota; this interaction is likely to be one of the mechanisms essential for Wnt3a-dependent neurite outgrowth
23396967 Wnt-induced dishevelled 2 phosphorylation has effects in in canonical and noncanonical Wnt3a and Wnt5a signaling
23382209 results indicate that SCN-iPS cells provide a useful disease model for SCN, and the activation of the Wnt3a/beta-catenin pathway may offer a novel therapy for SCN with ELANE mutation
23337036 Wnt3a mediates activation of Wnt/beta-catenin signaling and promotes tumorigenesis and tumor growth in experimental glioblastoma.
23276938 WNT3A promoted MSC proliferation via the ss-catenin-mediated canonical Wnt pathway, and inhibited chondrogenesis of mesenchymal stem cells via the calcium/calmodulin-dependent kinase II (CaMKII)-mediated non-canonical Wnt pathway.
23268410 The skin lesions of scleroderma patients showed obviously increased expression of cytoplasmic Wnt 2, nuclear Wnt 3a and beta-catenin, but markedly lowered cell membrane expression of beta-catenin than normal skin.
23204070 human bronchial epithelial cells are able to undergo epithelial-mesenchymal transition in vitro upon nicotine stimulation via the Wnt3a/beta-catenin signaling pathway.
23168335 During cell differentiation Wnt3a regulates Nkx2.5 and inhibits cardiomyogenesis.
22941468 overexpression of Wnt signaling pathway is associated with malignant breast cancer.
22876125 Wnt3a can induce epithelial-mesenchymal transition, migration, and proliferation of human lens epithelial cells, and may be a valuable therapeutic target for the prevention and treatment of posterior capsular opacification.
22824791 CPE forms a complex, probably through sequences located at its N-terminal domain, with Wnt3a and the extracellular cysteine rich domain of Fz1.
22789636 WNT3A putatively associates with primary osteoporosis.
22714865 Studies indicate he role of Wnt3a in osteoarthritis (OA)has been well investigated as its activity is reduced in OA.
22705156 WNT-3a as a novel upstream regulator of small GTPase activity in platelets
22550094 Growth inhibition of magnolol against human colon cancer cells can be partly attributed to the regulation of the Wnt3a/beta-catenin signaling pathway.
22396540 Combining BMP4/WNT3A induction and OCT4/EpCAM selection can significantly increase the putative germ cell population with meiotic competency.
22110662 HCV core protein enhances Wnt/beta-catenin signaling activity, hence playing an important role in HCV-associated carcinogenesis
22005028 Wnt3a signalling is upregulated in keloid fibroblasts and this promotes cellular growth, migration and extracellular matrix production in such fibroblasts.
21957254 Recombinant Sox17 prevents Wnt3a from repressing myelin protein expression, while inhibition of Sox17-mediated proteasomal degradation of beta-catenin blocks myelin protein induction.
21670201 when released from E-cadherin by Wnt3a-stimulated phosphorylation, p120-catenin controls the activity of Kaiso, enhancing its binding to repressed promoters and relieving its inhibition of the beta-catenin-Tcf-4 transcriptional complex.
21667018 In HEK293T cells with intact Wnt signaling, Rac1b is tethered to these same gene promoters independent of Wnt3A stimulation and is further observed to recruit Dishevelled and beta-catenin in the absence of Wnt3A stimulation.
21606194 Results indicate that CK1 isoforms work coordinately to promote the full response to Wnt3a stimulus.
21600099 The genetic variants of WNT3A gene may not be associated with the susceptibility to congenital scoliosis in a Chinese Han population.
21536751 WNT-3A modulates articular chondrocyte phenotype by activating both canonical and noncanonical pathways
21422228 These results provide strong evidence that the centrosomal localization of CK1delta is required for Wnt-3a-dependent neuritogenesis.
21123170 Forced expression of C4ST-1 in L-Wnt-3a cells inhibited diffusion of Wnt-3a due to structural alterations in CS chains mediated by C4ST-1.
20932509 two SNPs of Wnt3A (rs752107 and rs3121310) are significantly associated with NSCLP in Chinese population. These findings provide a context for understanding the genetic aetiology of NSCLP.
20932509 Observational study of gene-disease association. (HuGE Navigator)
20735988 Wnt-3a increases neurogenesis during the differentiation of ReNcell VM cells. Neurogenesis induced by Wnt-3a is independent of the transcriptional activity of Wnt/beta-catenin pathway in ReNcell VM cells.
20723538 These results support sFRP2's role as an enhancer of Wnt3A/beta-catenin signaling, a result with biological impact for both normal development and diverse pathologies such as tumorigenesis.
20693288 up-regulation of DPAGT1 transcripts by Wnt3a led to altered N-glycosylation of E-cadherin.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20347274 EP2 is a novel transcriptional target of Wnt3a in dermal papilla cells of human scalp hair follicles
20336604 Studies indicate that understanding the contributions of Notch, Wnt and HH signaling to the development of hematopoiesis is critical for achieving successful ex vivo expansion and differentiation of hematopoietic stem cells hematopoietic stem cells.
20227366 Loss of CYLD instigates tumor growth in human cylindromatosis through a mechanism in which hyperubiquitination of polymerized Dvl drives enhancement of Wnt3/beta-catenin responses.
20093360 analysis of the frizzled8.Wnt3a.LRP6 signaling complex reveals multiple Wnt and Dkk1 binding sites on LRP6
20085589 Wnt/beta-catenin pathway activation might upregulate DIXDC1 through a post-translational mechanism by inhibiting the ubiquitin-mediated degradation of the DIXDC1 protein.
19901330 Data demonstrate that the Wnt-beta-catenin signaling pathway is functional in platelets, and that a Wnt3a ligand inhibits platelet adhesion, activation, dense granule secretion, and aggregation.
19887570 Wnt-3A may activate canonical Wnt signaling and PI3K/AKT through distinct receptors.
19881541 Wnt3A treatment greatly enhanced the effect of LRP6 on T-cell factor/lymphoid enhance factor luciferase activity in human mammary epithelial cells
19816934 Data show that mutated GPC3 lacking the GPI anchoring domain (sGPC3) significantly inhibited the in vivo growth, blocked Wnt signaling and Erk1/2 and Akt phosphorylation in tumors.
19523451 Wnt3a induces canonical and non-canonical Wnt signaling in HUVECs, and stimulates their proliferation and migration.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19351711 The presence of WNT3a completely prevents normal adipocyte differentaiton.
19265664 Our study reveals an unappreciated role for noncanonical Wnt signaling in hESC specification that involves development of unique mesoderm precursors via morphogenic organization within human EBs.
19144919 These findings suggest that WNT3A can mediate transcriptional changes in melanoma cells in a manner reminiscent of the known role of Wnt/beta-catenin signaling in normal melanocyte development.
18724388 the frequent loss of stromal TGF-beta type II receptor expression in prostate cancer can relieve the paracrine suppression of Wnt3a expression
18719101 essential role of Wnt3a in hepatocyte differentiation from hESCs; Wnt3a facilitates clonal plating of hESCs exhibiting functional hepatic differentiation
18632632 Wnt3a and Wnt5a have roles in inducing BMP-4 and 6 expression in prostate cancer osteoblast differentiation
18615587 both Wnt5a and Wnt3a bound Ror2, only Wnt5a induced Ror2 homo-dimerization and tyrosine phosphorylation in U2OS human osteoblastic cells.
18555765 glutamine synthetase has a role in control of glutamate signalling through Wnt3A and steroid pathways in osteoblastic cells
18505824 FGF antagonizes Wnt signaling by inhibiting Wnt-induced transcription and suggest that multiple mechanisms, including downregulation of TCFs and Wnt receptors, contribute to this effect.
18462958 study demonstrated that Wnt3a & Wnt5a can promote proliferation of HEK293 cells & inhibit serum starvation-induced apoptosis, which implies Wnt3a & Wnt5a can maintain survival of HEK293 cells under stress
18413325 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18344425 effect of Wnt3a on bone disease and growth of multiple myeloma cells in vitro and in vivo
18305214 bone marrow sera from 21 multiple myeloma patients significantly suppressed Wnt3a-induced OPG expression and enhanced RANKL expression in osteoblasts in a DKK1-dependent manner
18242164 Our results suggest that Wnt/beta-catenin signaling plays important roles in human fetal skin development and homeostasis, which also provide new insights on the molecular mechanisms of oncogenesis in human epidermis.
17990294 Wnt3a markedly reduced the forskolin-induced expression of RANKL, a target gene of PTH/cAMP/PKA.
17888180 Observational study of gene-disease association. (HuGE Navigator)
17822920 These findings demonstrate a requirement of Wnt signaling for maintenance, proliferation, and survival of NP when cultured in neurosphere conditions.
17698587 Results identify a novel feedback mechanism by which Wnt, including Wnt3a, negatively regulates LRP6 at the mRNA level.
17595165 Blockade of Wnt3a stimulation of IP(5) generation blocks beta-catenin accumulation
17546602 These results suggest that Wnt signaling crosstalk and functional antagonism with the LRP5 co-receptor are key signaling regulators of mesenchymal stem cells maintenance and differentiation.
17544413 Wnt3A treatment significantly activated human hepatic stellate cells, while this was inhibited in secreted frizzled-related protein 1 (sFRP1) overexpressing cells.
17458904 Wnt3A/5A can function as mesenchymal regulatory factors by providing instructive cues for the recruitment, maintenance, and differentiation of mesenchymal stem cells.
17211448 Over-expression of the Wnt3a gene significantly enhances the ability of fibroblast feeder cells to support the undifferentiated growth of 3 different human embryonic stem cell lines.
17137849 Wnt-LRP5 signalling may play a role in the adaptation of bone to mechanical load in humans, and may explain some gender-related differences in bone mass
16799642 ILK activity can modulate acute Wnt3a mediated beta-catenin phosphorylation, stabilization and nuclear activation in a PI3K-independent manner.
16621789 BMP-2 antagonizes Wnt-3a signaling in osteoblast progenitors by promoting an interaction between Smad1 and Dvl-1 that restricts beta-catenin activation
16565323 Wnt/beta-catenin pathway activation by Wnt3a raised beta-catenin in monocytes & decreased migration thru a dermal microvascular endothelial cell layer. This was associated with specific monocyte adherence to endothelial cells after Wnt3a exposure.
14722104 Wnt3a may stimulate a cellular phosphatase to dephosphorylate and activate CKIepsilon
12805222 Results suggest that disabled-2 functions as a negative regulator of canonical Wnt signaling by stabilizing the beta-catenin degradation complex.
12629517 These results suggest that Wnt responsiveness is a stage-specific phenomenon in B-cell development and that the morphological changes associated with Wnt signaling may play a role in the motility and metastatic potential of myeloma cells.
12556519 CKI epsilon-dependent phosphorylation of Dvl enhances the formation of a complex of Dvl-1 with Frat-1 and this complex leads to the activation of Wnt-3a-induced accumulation of beta-catenin
12052822 wnt3a-beta catenin signaling regulates LEF-1 gene expression
11836627 Clustered with WNT14 on 1q42.
11788904 Regulation of WNT3 and WNT3A mRNAs in human cancer cell lines NT2, MCF-7, and MKN45

AA Sequence

MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGI      1 - 70
KIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSS     71 - 140
RHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSG    141 - 210
SCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNF    211 - 280
CEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHT    281 - 350
CK                                                                        351 - 352
//

Text Mined References (147)

PMID Year Title
27138857 2016 Wnt pathway activation by ADP-ribosylation.
26687115 2016 The microRNA-29 family in cartilage homeostasis and osteoarthritis.
26643293 2016 Wnt3a suppresses Wnt/?-catenin signaling and cancer cell proliferation following serum deprivation.
26266404 2015 Wnt3a Promotes the Vasculogenic Mimicry Formation of Colon Cancer via Wnt/?-Catenin Signaling.
25848952 2015 Transcriptome analysis of Wnt3a-treated triple-negative breast cancer cells.
25805505 2015 Number and brightness analysis of sFRP4 domains in live cells demonstrates vesicle association signal of the NLD domain and dynamic intracellular responses to Wnt3a.
25731175 2015 Notum deacylates Wnt proteins to suppress signalling activity.
25656539 2015 Wnt-mediated protein stabilization ensures proper mitotic microtubule assembly and chromosome segregation.
25651906 2015 Wnt3a signal pathways activate MyoD expression by targeting cis-elements inside and outside its distal enhancer.
25572698 2015 Wnt3a increases the metastatic potential of non-small cell lung cancer cells in vitro in part via its upregulation of Notch3.
25556760 2015 Wnt Acts as a Prosurvival Signal to Enhance Dentin Regeneration.
25499541 2014 Wnt3a expression is associated with epithelial-mesenchymal transition and promotes colon cancer progression.
25425204 2015 Sequence and structural difference favors a distinct preference of Wnt3a binding with co-receptor LRP6.
25359619 2014 Wnt signaling induces gene expression of factors associated with bone destruction in lung and breast cancer.
25301448 2015 Blocking of the interaction between Wnt proteins and their co-receptors contributes to the anti-tumor effects of adenovirus-mediated DKK3 in glioblastoma.
25174704 2014 MicroRNA-195 acts as a tumor suppressor by directly targeting Wnt3a in HepG2 hepatocellular carcinoma cells.
25147340 2014 Canonical Wnt signaling induces vascular endothelial dysfunction via p66Shc-regulated reactive oxygen species.
25143377 2014 Tyrosine-based signal mediates LRP6 receptor endocytosis and desensitization of Wnt/?-catenin pathway signaling.
24991956 2014 Wnt-Fzd signaling sensitizes peripheral sensory neurons via distinct noncanonical pathways.
24841207 2014 Disulfide bond requirements for active Wnt ligands.
24817932 2014 WNT3A gene expression is associated with isolated Hirschsprung disease polymorphism and disease status.
24768165 2014 WLS retrograde transport to the endoplasmic reticulum during Wnt secretion.
24686518 2014 Effect of Wnt3a on keratinocytes utilizing in vitro and bioinformatics analysis.
24584697 2014 WNT3A gene polymorphisms are associated with bone mineral density variation in postmenopausal mestizo women of an urban Mexican population: findings of a pathway-based high-density single nucleotide screening.
24564183 2014 Wnt3a expression is associated with MMP-9 expression in primary tumor and metastatic site in recurrent or stage IV colorectal cancer.
24510127 2014 Canonical Wnt signalling activates TAZ through PP1A during osteogenic differentiation.
24449494 2014 Dysfunction of Wnt signaling and synaptic disassembly in neurodegenerative diseases.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24346024 2013 Surface topography regulates wnt signaling through control of primary cilia structure in mesenchymal stem cells.
24340027 2013 Crosstalk between Wnt/?-catenin and estrogen receptor signaling synergistically promotes osteogenic differentiation of mesenchymal progenitor cells.
24321072 2013 [Overexpression of Wnt3a inhibited the apoptosis of mouse embryonic liver stem cells].
24292069 2014 Single-cell imaging of Wnt palmitoylation by the acyltransferase porcupine.
24265322 2014 ?-arrestin promotes Wnt-induced low density lipoprotein receptor-related protein 6 (Lrp6) phosphorylation via increased membrane recruitment of Amer1 protein.
24209998 2013 Wnt signaling in triple negative breast cancer is associated with metastasis.
24052942 2013 WNT3A promotes hematopoietic or mesenchymal differentiation from hESCs depending on the time of exposure.
23999248 2013 Characterization of Wnt/?-catenin signaling in rhabdomyosarcoma.
23954131 2013 Canonical Wnt signaling negatively modulates regulatory T cell function.
23893409 2013 Receptor tyrosine kinase-like orphan receptor 2 (Ror2) expression creates a poised state of Wnt signaling in renal cancer.
23559372 2013 Paracrine Wnt signaling both promotes and inhibits human breast tumor growth.
23509994 2013 High disease activity in ankylosing spondylitis is associated with increased serum sclerostin level and decreased wingless protein-3a signaling but is not linked with greater structural damage.
23396968 2013 Atypical protein kinase C? is required for Wnt3a-dependent neurite outgrowth and binds to phosphorylated dishevelled 2.
23396967 2013 Functional consequences of Wnt-induced dishevelled 2 phosphorylation in canonical and noncanonical Wnt signaling.
23382209 2013 Wnt3a stimulates maturation of impaired neutrophils developed from severe congenital neutropenia patient-derived pluripotent stem cells.
23337036 2013 Wnt3a mediated activation of Wnt/?-catenin signaling promotes tumor progression in glioblastoma.
23276938 2013 WNT3A modulates chondrogenesis via canonical and non-canonical Wnt pathways in MSCs.
23268410 2012 [Role of Wnt 2, Wnt 3a and ?-catenin in skin lesions of patients with scleroderma].
23204070 2013 Nicotine-induced epithelial-mesenchymal transition via Wnt/?-catenin signaling in human airway epithelial cells.
23168335 2013 Myosin phosphatase modulates the cardiac cell fate by regulating the subcellular localization of Nkx2.5 in a Wnt/Rho-associated protein kinase-dependent pathway.
22988876 2012 The importance of Wnt signalling for neurodegeneration in Parkinson's disease.
22941468 2012 Differential gene expression of Wnt signaling pathway in benign, premalignant, and malignant human breast epithelial cells.
22876125 2012 Wnt3a promotes epithelial-mesenchymal transition, migration, and proliferation of lens epithelial cells.
22824791 2013 Carboxypeptidase E: a negative regulator of the canonical Wnt signaling pathway.
22789636 2012 Rare variations in WNT3A and DKK1 may predispose carriers to primary osteoporosis.
22714865 2012 Cartilage development and degeneration: a Wnt Wnt situation.
22705156 2012 WNT-3a modulates platelet function by regulating small GTPase activity.
22682250 2012 Complement C1q activates canonical Wnt signaling and promotes aging-related phenotypes.
22550094 2012 Wnt/?-catenin signaling mediates the antitumor activity of magnolol in colorectal cancer cells.
22396540 2012 Meiotic competent human germ cell-like cells derived from human embryonic stem cells induced by BMP4/WNT3A signaling and OCT4/EpCAM (epithelial cell adhesion molecule) selection.
22110662 2011 Enhancement of canonical Wnt/?-catenin signaling activity by HCV core protein promotes cell growth of hepatocellular carcinoma cells.
22005028 2011 Keloid fibroblasts are more sensitive to Wnt3a treatment in terms of elevated cellular growth and fibronectin expression.
21957254 2011 SRY-box containing gene 17 regulates the Wnt/?-catenin signaling pathway in oligodendrocyte progenitor cells.
21670201 2011 Wnt controls the transcriptional activity of Kaiso through CK1?-dependent phosphorylation of p120-catenin.
21667018 2011 Rac1b recruits Dishevelled and ?-catenin to Wnt target gene promoters independent of Wnt3A stimulation.
21606194 2011 Coordinated action of CK1 isoforms in canonical Wnt signaling.
21600099 2011 [Association study of WNT3A gene polymorphisms with the susceptibility to congenital scoliosis in a Chinese Han population].
21536751 2011 WNT-3A modulates articular chondrocyte phenotype by activating both canonical and noncanonical pathways.
21422228 2011 Casein kinase 1 delta functions at the centrosome to mediate Wnt-3a-dependent neurite outgrowth.
21244856 2011 Fatty acid modification of Wnt1 and Wnt3a at serine is prerequisite for lipidation at cysteine and is essential for Wnt signalling.
21123170 2011 Down-regulation of chondroitin 4-O-sulfotransferase-1 by Wnt signaling triggers diffusion of Wnt-3a.
20932509 2011 Association of Wnt3A gene variants with non-syndromic cleft lip with or without cleft palate in Chinese population.
20826466 2010 WLS-dependent secretion of WNT3A requires Ser209 acylation and vacuolar acidification.
20735988 2010 Differentiation of human neural progenitor cells regulated by Wnt-3a.
20723538 2010 Secreted Frizzled-related protein-2 (sFRP2) augments canonical Wnt3a-induced signaling.
20693288 2010 N-glycosylation gene DPAGT1 is a target of the Wnt/beta-catenin signaling pathway.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20559569 2010 Endogenous Wnt/beta-catenin signaling is required for cardiac differentiation in human embryonic stem cells.
20412773 2010 The Hippo pathway regulates Wnt/beta-catenin signaling.
20393562 2010 APCDD1 is a novel Wnt inhibitor mutated in hereditary hypotrichosis simplex.
20347274 2010 Identification of transcriptional targets of Wnt/beta-catenin signaling in dermal papilla cells of human scalp hair follicles: EP2 is a novel transcriptional target of Wnt3a.
20336604 2010 Novel roles for Notch, Wnt and Hedgehog in hematopoesis derived from human pluripotent stem cells.
20227366 2010 Loss of the tumor suppressor CYLD enhances Wnt/beta-catenin signaling through K63-linked ubiquitination of Dvl.
20137080 2010 Helicobacter pylori-induced activation of beta-catenin involves low density lipoprotein receptor-related protein 6 and Dishevelled.
20093360 2010 Reconstitution of a frizzled8.Wnt3a.LRP6 signaling complex reveals multiple Wnt and Dkk1 binding sites on LRP6.
20085589 2010 Wnt signaling stabilizes the DIXDC1 protein through decreased ubiquitin-dependent degradation.
19901330 2009 Canonical Wnt signaling negatively regulates platelet function.
19887570 2010 Wingless (Wnt)-3A induces trophoblast migration and matrix metalloproteinase-2 secretion through canonical Wnt signaling and protein kinase B/AKT activation.
19881541 2010 Wnt signaling activation and mammary gland hyperplasia in MMTV-LRP6 transgenic mice: implication for breast cancer tumorigenesis.
19816934 2010 Soluble glypican 3 inhibits the growth of hepatocellular carcinoma in vitro and in vivo.
19736317 2009 Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate.
19523451 2009 Wnt3a regulates proliferation and migration of HUVEC via canonical and non-canonical Wnt signaling pathways.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19351711 2009 Impaired preadipocyte differentiation in human abdominal obesity: role of Wnt, tumor necrosis factor-alpha, and inflammation.
19265664 2009 Noncanonical Wnt signaling orchestrates early developmental events toward hematopoietic cell fate from human embryonic stem cells.
19144919 2009 Activated Wnt/beta-catenin signaling in melanoma is associated with decreased proliferation in patient tumors and a murine melanoma model.
19101069 2009 beta-catenin is involved in N-cadherin-dependent adhesion, but not in canonical Wnt signaling in E2A-PBX1-positive B acute lymphoblastic leukemia cells.
19072540 2009 Modulation of Wnt signaling through inhibition of secreted frizzled-related protein I (sFRP-1) with N-substituted piperidinyl diphenylsulfonyl sulfonamides.
18941195 2008 Soluble frizzled-related protein 1 is estrogen inducible in bone marrow stromal cells and suppresses the earliest events in lymphopoiesis.
18724388 2008 Prostate tumor progression is mediated by a paracrine TGF-beta/Wnt3a signaling axis.
18719101 2008 Highly efficient differentiation of hESCs to functional hepatic endoderm requires ActivinA and Wnt3a signaling.
18632632 2008 Prostate cancer induces bone metastasis through Wnt-induced bone morphogenetic protein-dependent and independent mechanisms.
18615587 2008 Wnt5a induces homodimerization and activation of Ror2 receptor tyrosine kinase.
18555765 2008 Wnt and steroid pathways control glutamate signalling by regulating glutamine synthetase activity in osteoblastic cells.
18505824 2008 Fibroblast growth factor signaling uses multiple mechanisms to inhibit Wnt-induced transcription in osteoblasts.
18462958 2008 Effects of Wnt proteins on cell proliferation and apoptosis in HEK293 cells.
18413325 2008 Variation in WNT genes is associated with non-syndromic cleft lip with or without cleft palate.
18344425 2008 Wnt3a signaling within bone inhibits multiple myeloma bone disease and tumor growth.
18305214 2008 Myeloma-derived Dickkopf-1 disrupts Wnt-regulated osteoprotegerin and RANKL production by osteoblasts: a potential mechanism underlying osteolytic bone lesions in multiple myeloma.
18242164 2008 Effects of Wnt3a on proliferation and differentiation of human epidermal stem cells.
17990294 2008 PTH/cAMP/PKA signaling facilitates canonical Wnt signaling via inactivation of glycogen synthase kinase-3beta in osteoblastic Saos-2 cells.
17976063 2007 Effects of grade of oocyte-cumulus complex and the interactions between grades on the production of blastocysts in the cow, ewe and lamb.
17888180 2007 Lack of evidence of WNT3A as a candidate gene for congenital vertebral malformations.
17822920 2007 Wnt3a regulates survival, expansion, and maintenance of neural progenitors derived from human embryonic stem cells.
17698587 2007 Analysis of endogenous LRP6 function reveals a novel feedback mechanism by which Wnt negatively regulates its receptor.
17595165 2007 Inositol pentakisphosphate mediates Wnt/beta-catenin signaling.
17546602 2007 Cross-talk between Wnt signaling pathways in human mesenchymal stem cells leads to functional antagonism during osteogenic differentiation.
17544413 2007 Wnt signaling enhances the activation and survival of human hepatic stellate cells.
17458904 2007 Canonical and non-canonical Wnts differentially affect the development potential of primary isolate of human bone marrow mesenchymal stem cells.
17211448 2007 Promoting human embryonic stem cell renewal or differentiation by modulating Wnt signal and culture conditions.
17137849 2007 Genetic variation at the low-density lipoprotein receptor-related protein 5 (LRP5) locus modulates Wnt signaling and the relationship of physical activity with bone mineral density in men.
16890161 2006 Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation of beta-catenin.
16799642 2006 Modulation of Wnt3a-mediated nuclear beta-catenin accumulation and activation by integrin-linked kinase in mammalian cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16678095 2006 Wntless, a conserved membrane protein dedicated to the secretion of Wnt proteins from signaling cells.
16621789 2006 A dishevelled-1/Smad1 interaction couples WNT and bone morphogenetic protein signaling pathways in uncommitted bone marrow stromal cells.
16565323 2006 Wnt signaling regulates transendothelial migration of monocytes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16227623 2005 Processing by convertases is not required for glypican-3-induced stimulation of hepatocellular carcinoma growth.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454084 2004 Mammalian Ryk is a Wnt coreceptor required for stimulation of neurite outgrowth.
14739301 2004 The low density lipoprotein receptor-1, LRP1, interacts with the human frizzled-1 (HFz1) and down-regulates the canonical Wnt signaling pathway.
14722104 2004 Regulation of casein kinase I epsilon activity by Wnt signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12897152 2003 A novel mechanism for Wnt activation of canonical signaling through the LRP6 receptor.
12805222 2003 Regulation of the Wnt signaling pathway by disabled-2 (Dab2).
12629517 2003 Wnt signaling in B-cell neoplasia.
12556519 2003 Casein kinase I epsilon enhances the binding of Dvl-1 to Frat-1 and is essential for Wnt-3a-induced accumulation of beta-catenin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12067714 2002 Direct interaction of Frizzled-1, -2, -4, and -7 with PDZ domains of PSD-95.
12052822 2002 Wnt-3A/beta-catenin signaling induces transcription from the LEF-1 promoter.
11836627 2002 Molecular cloning and expression of mouse Wnt14, and structural comparison between mouse Wnt14-Wnt3a gene cluster and human WNT14-WNT3A gene cluster.
11788904 2002 Regulation of WNT3 and WNT3A mRNAs in human cancer cell lines NT2, MCF-7, and MKN45.
11414706 2001 Molecular cloning and characterization of WNT3A and WNT14 clustered in human chromosome 1q42 region.
10866835 2000 The evolutionarily conserved porcupine gene family is involved in the processing of the Wnt family.
10654605 2000 SHH-N upregulates Sfrp2 to mediate its competitive interaction with WNT1 and WNT4 in the somitic mesoderm.
10557084 1999 Human frizzled 1 interacts with transforming Wnts to transduce a TCF dependent transcriptional response.
8168088 1994 Differential expression of human Wnt genes 2, 3, 4, and 7B in human breast cell lines and normal and disease states of human breast tissue.
8167409 1993 Wnt family proteins are secreted and associated with the cell surface.