Property Summary

Ligand Count 16
NCBI Gene PubMed Count 166
PubMed Score 473.84
PubTator Score 287.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Obesity 678 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Disease Target Count
Juvenile osteoporosis 4
Disease Target Count P-value
lung adenocarcinoma 2716 5.4e-10
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count
Osteoporosis, Juvenile 4

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.500 5.4e-10

 GWAS Trait (1)

Gene RIF (131)

AA Sequence

MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGI      1 - 70
KIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSS     71 - 140
RHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSG    141 - 210
SCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNF    211 - 280
CEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHT    281 - 350
CK                                                                        351 - 352
//

Text Mined References (171)

PMID Year Title