Property Summary

Ligand Count 8
NCBI Gene PubMed Count 58
PubMed Score 99.49
PubTator Score 78.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Cleft Lip 141
Cleft Palate 271
Abnormal lung lobation 10
Abnormal vertebral ossification 5
Abnormality of the larynx 6
Abnormally small eyeball 97
Absence of rib 7
Absent external genitalia 2
Agenesis of corpus callosum 83
Anus, Imperforate 46
Aplasia/Hypoplasia involving the nose 5
Aplasia/Hypoplasia involving the pelvis 2
Aplasia/Hypoplasia of the lungs 13
Atresia of vagina 10
Autosomal recessive predisposition 1442
Cataract 297
Choanal Atresia 42
Cleft palate with cleft lip 23
Coloboma of iris 38
Congenital absence of adrenal gland 2
Congenital absence of kidney 31
Congenital absence of spleen 10
Congenital hypoplasia of lung 48
Congenital hypoplasia of nose 5
Congenital small ears 48
Corneal diameter decreased 47
Cryptorchidism 296
Decreased size of eyeball 97
Diaphragmatic defect 1
Gastroschisis 11
Hydrocephalus 152
Hypoplastic mandible condyle 275
Hypoplastic pelvis 9
Hypotrophic nose 5
Lens Opacities 231
Low set ears 181
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse 12
Mandibular hypoplasia 275
Microcornea 47
Micrognathism 275
Microphthalmos 100
Microstomia 78
Multicystic Dysplastic Kidney 52
Nipples absent or rudimentary 3
Optic Atrophy 242
Oral cleft 18
Peripheral pulmonary vessel aplasia 1
Polyhydramnios 108
Rudimentary fallopian tubes 2
Septo-Optic Dysplasia 11
Single naris 2
Single umbilical artery 5
Tetraamelia multiple malformations 1
Tracheal stenosis 23
Uranostaphyloschisis 167
Urethral atresia 4
malignant mesothelioma 3232
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 3.338 1.7
Disease Target Count Z-score Confidence
Bladder exstrophy 32 3.371 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
chronic lymphosyte leukemia 1.700 1.1e-03
facioscapulohumeral dystrophy 1.300 4.4e-02
group 3 medulloblastoma 1.300 2.1e-03
lung adenocarcinoma 1.200 1.9e-06
posterior fossa group A ependymoma 1.100 1.2e-04

Protein-protein Interaction (1)

Gene RIF (39)

AA Sequence

MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSVA      1 - 70
EGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICG     71 - 140
CDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHG    141 - 210
LSGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENS    211 - 280
PNFCEPNPETGSFGTRDRTCNVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYD    281 - 350
VHTCK                                                                     351 - 355
//

Text Mined References (57)

PMID Year Title