Property Summary

NCBI Gene PubMed Count 33
PubMed Score 53.42
PubTator Score 41.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.900 3.1e-07
astrocytic glioma -1.700 4.4e-03
ependymoma -1.500 1.3e-02
oligodendroglioma -1.900 3.2e-03
cystic fibrosis -4.747 7.3e-08
medulloblastoma, large-cell -1.100 1.0e-03
pilocytic astrocytoma 1.100 3.3e-03
acute myeloid leukemia -1.300 2.9e-02
psoriasis -1.800 4.8e-35
ovarian cancer -5.800 5.6e-18
chronic rhinosinusitis -1.115 1.9e-02

 GWAS Trait (1)

Protein-protein Interaction (13)

Gene RIF (18)

PMID Text
26548512 the present study detected abnormal upregulation in the levels of Wnt2b and Wnt7b, and hypothesized that the alterations may be due to the ectopic opening of chromatin structure.
25356045 ACSL5 mediates antiproliferative activities via Wnt2B palmitoylation with diminished Wnt activity. The molecular pathway is probably relevant for intestinal homeostasis, overwhelmed by other pathways in carcinogenesis.
25297925 Results showed that miR-185-3p contributs to radioresistance of nasopharyngeal carcinoma via modulation of WNT2B expression.
25120849 these results indicate that the high-expression levels of Gli1 and Wnt2B might play a pivotal role during tumorigenesis of pancreatic cancer
23785285 secretion of WNT2B and WNT9B and stabilization of beta-catenin (CTNNB1) upon virus infection negatively regulate expression of representative inducible genes IFNB1, IFIT1 and TNF in a CTNNB1-dependent effector mechanism
22635028 High Wnt2B overexpression is associated with ovarian cancer metastasis and drug resistance.
20844743 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19650845 Observational study of gene-disease association. (HuGE Navigator)
19360354 Hedgehog signals and bHLH transcription factors are involved in WNT2B upregulation, which is counteracted by BMP, WNT and Notch signals.
18606951 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17649721 Heplipin induced KG-1 cell apoptosis is related with Wntl3 and ATPase3.
16407296 in addition to alternative promoters and RNA splicing, an alternative translation start in Wnt13B and Wnt13C mRNAs increases the complexity of both human wnt13 expression and functions
16273293 REVIEW: Anti-WNT2B monoclonal antibodies, WNT2B RNAi compounds, or small molecule WNT2B inhibitors could be developed as novel therapeutic agents for gastric cancer and esophageal cancer in the field of clinical oncology.
12072409 Wnt-2b mRNA is expressed in human ovarian cancer cells
11712082 This is the first report on differential regulation of WNT2 and WNT2B mRNAs in human cancer cell lines.

AA Sequence

MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLTLPARVDTSWWYIGALGARV      1 - 70
ICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAA     71 - 140
FVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRL    141 - 210
KDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQD    211 - 280
GANFTAARQGYRRATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVT    281 - 350
RVTQCECKFHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT                                 351 - 391
//

Text Mined References (36)

PMID Year Title
26548512 2016 Abnormal epigenetic regulation of the gene expression levels of Wnt2b and Wnt7b: Implications for neural tube defects.
25356045 2014 Modulating effects of acyl-CoA synthetase 5-derived mitochondrial Wnt2B palmitoylation on intestinal Wnt activity.
25297925 2014 miR-185-3p regulates nasopharyngeal carcinoma radioresistance by targeting WNT2B in vitro.
25120849 2014 Expression of Gli1 and Wnt2B correlates with progression and clinical outcome of pancreatic cancer.
23785285 2013 Genome-wide RNAi screen reveals a new role of a WNT/CTNNB1 signaling pathway as negative regulator of virus-induced innate immune responses.
23583221 2013 MicroRNA-324-3p regulates nasopharyngeal carcinoma radioresistance by directly targeting WNT2B.
22635028 2012 Silencing Wnt2B by siRNA interference inhibits metastasis and enhances chemotherapy sensitivity in ovarian cancer.
20844743 2010 Single nucleotide polymorphisms in the Wnt and BMP pathways and colorectal cancer risk in a Spanish cohort.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19650845 2010 CLC- a novel susceptibility gene for allergic rhinitis?
19360354 2009 Transcriptional regulation of WNT2B based on the balance of Hedgehog, Notch, BMP and WNT signals.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
18606951 2008 Association study of Wnt signaling pathway genes in bipolar disorder.
18155664 2008 Upstream open reading frames regulate the expression of the nuclear Wnt13 isoforms.
17848411 2007 Developmental changes in human fetal testicular cell numbers and messenger ribonucleic acid levels during the second trimester.
17649721 2007 [Identification of heplipin inducing apoptosis-related genes in KG-1 human leukemia cells by differential display RT-PCR].
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16407296 2006 Mitochondrial and nuclear forms of Wnt13 are generated via alternative promoters, alternative RNA splicing, and alternative translation start sites.
16273293 2005 WNT2B: comparative integromics and clinical applications (Review).
16258938 2006 Expression patterns of Wnt genes during development of an anterior part of the chicken eye.
15754012 2005 Molecular evolution of Wnt2b orthologs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164427 2004 Wnt genes define distinct boundaries in the developing human brain: implications for human forebrain patterning.
15135146 2004 Demineralized bone alters expression of Wnt network components during chondroinduction of post-natal fibroblasts.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12072409 2002 Wnt signaling in the ovary: identification and compartmentalized expression of wnt-2, wnt-2b, and frizzled-4 mRNAs.
11741304 2001 WNT2B2 mRNA, up-regulated in primary gastric cancer, is a positive regulator of the WNT- beta-catenin-TCF signaling pathway.
11712082 2001 Differential regulation of WNT2 and WNT2B expression in human cancer.
10944466 2000 Alternative splicing of the WNT-2B/WNT-13 gene.
9787155 1998 Role of members of the Wnt gene family in human hematopoiesis.
9441749 1997 Isolation of two novel WNT genes, WNT14 and WNT15, one of which (WNT15) is closely linked to WNT3 on human chromosome 17q21.
8761309 1996 Cloning, expression and chromosomal localization of Wnt-13, a novel member of the Wnt gene family.
8167409 1993 Wnt family proteins are secreted and associated with the cell surface.