Property Summary

NCBI Gene PubMed Count 67
PubMed Score 155.55
PubTator Score 276.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.929 7.4e-08
colon cancer 1.300 1.6e-02
pancreatic cancer 1.300 8.2e-05
interstitial cystitis 1.500 2.1e-02
lung carcinoma -1.500 1.1e-14
psoriasis -3.000 1.3e-85

Protein-protein Interaction (9)

Gene RIF (45)

PMID Text
26484565 Wnt2 complements Wnt/beta-catenin signaling in regulating colorectal cancer cell proliferation.
26116230 Wnt2/beta-catenin signaling was involved in stromal-epithelial cells interaction in endometriosis.
25731618 High expression of Wnt2 is associated with pancreatic cancer progression promoted by pancreatic stellate cells.
25472883 HIV-1 Tat specifically associates with WNT2 promoter to upregulate WNT2 expression in T cells
23815780 We demonstrated an activation of Wnt-2 signaling via the Frizzled-8 receptor in non-small cell lung cancer cells
23694962 Hypermethylation of WNT2 is associated with colorectal cancer.
23603171 The study demonistrated that expressions of Wnt-2 in high-grade brainstem gliomas were significantly higher than that in low-grade brainstem gliomas and normal brain tissues and were positively correlated with the expression of Ki-67.
23322712 Decreased placental expression of Wnt2 and increased placental expression of sFRP4 may be associated with the pathogenesis of severe preeclampsia.
23268410 The skin lesions of scleroderma patients showed obviously increased expression of cytoplasmic Wnt 2, nuclear Wnt 3a and beta-catenin, but markedly lowered cell membrane expression of beta-catenin than normal skin.
22949635 Pdgf signaling potentiates Wnt2-Wnt7b signaling to promote high levels of Wnt activity in mesenchymal progenitors that is required for proper development of endoderm-derived organs, such as the lung
22763454 Expression of WNT2 in pancreatic cancer cells suppresses anoikis, enhances anchorage-independent sphere formation, and increases metastatic propensity in vivo.
22522212 The WNT2 gene may play a suggestive role in language development in autistic disorder.
22489561 significant association with SNP rs4730775 locus on chromosome 7 with genetic susceptibility to Peyronie's disease
22041457 Wnt/beta-catenin pathway forms a negative feedback loop during TGF-beta1 induced human normal skin fibroblast-to-myofibroblast transition
21575668 a haplotype of WNT2 (rs2896218-rs6950765: G-G) is significantly associated with ASDs.
21474991 DNA methylation within the WNT2 promoter in human placenta is associated with low birthweight.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20492734 The present study does not support a major role for WNT2 in schizophrenia.
20492734 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19895723 findings provide evidence for a significant association between WNT2 and autism.
19895723 Observational study of gene-disease association. (HuGE Navigator)
19857041 Wnt2/beta-catenin signaling pathway is constitutively activated in esophageal squamous cell carcinoma (ESCC) cells, indicating that Wnt2/beta-catenin pathway plays an essential role in carcinogenesis of the esophagus.
19734317 These data demonstrate that mesenchymal stem cells from mice and humans produce Wnt proteins and TGF-beta1 that respectively stimulate lung fibroblast proliferation and matrix production.
19444628 Wnt2 acts as an angiogenic factor for non-sinusoidal endothelium in vitro and in vivo.
19421142 RNA samples from 21 neuroblastoma showed a highly significant FZD1 and/or MDR1 overexpression after treatment, underlining a role for FZD1-mediated Wnt/beta-catenin pathway in clinical chemoresistance.
19239325 up-regulation of the Wnt-2 protein might play a role in the development of colorectal cancers.
19058789 Observational study of gene-disease association. (HuGE Navigator)
19038973 The results suggest that WNT2 could act through its receptor FZD9 to regulate the beta-CATENIN pathway in cumulus cells, recruiting beta-CATENIN into plasma membranes and promoting the formation of adherens junctions involving CDH1.
18949017 Knockdown of Wnt2 by siRNA in human U251 glioma cells inhibited cell proliferation and invasive ability, and induced apoptotic cell death
18703315 Wnt (Wnt2), Stat3, and Notch-1 and -2 signaling are correlated in human epidermal tumors.
18600204 Persistent upregulation in colorectal carcinoma cases studied.
18184402 potential coordinative effects of Wnt, NF-kappaB and/or Stat3 activation on gastric cancer formation presumably by promoting the transcription of their common target genes.
17534895 inhibition of both Wnt-2 and Gal-3 had synergistic effects on suppressing canonical Wnt signaling and inducing apoptosis, suggesting that aberrant canonical Wnt/beta-catenin signaling in colorectal cancer can be regulated at multiple levels
17386109 Regulation of Fz4 expression by Wnt2.
16407829 The WNT2 gene is upregulated along the progression from low-grade dysplasia to esophageal adenocarcioma.
16132582 The increased Wnt2 expression in gastric cancers is paralleled with reduction of membranous E-cadherin.
15900580 Inhibition of Wnt2 by monoclonal antibodies is of therapeutic interest in the development of more effective treatments for malignnt pleueral mesothelioma.
15896469 Wnt/beta-catenin signalling pathway is activated in most of gastric cancers, which may play pivotal roles either in gastric cancer formation or in tumour invasion and dissemination
15878915 Target genes involved in tumor WNT pathways in response to TGF-beta1 were found in cervix cancer cells.
15048648 Our interpretation of these findings is that it is unlikely that DNA variations in RELN and WNT2 play a significant role in the genetic predisposition to autism.
14533014 REVIEW: role in human gastrointestinal cancer
11840514 Activating mutations of the WNT2 gene are not a major contributor to the development of autistic disorder.
11712082 Up-regulation of WNT2 mRNA by estrogen might play a key role in some cases of human breast cancer through activation of the beta-catenin - TCF signaling pathway.

AA Sequence

MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPDVMRAISQGVA      1 - 70
EWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGEVKSCSCDPK     71 - 140
KMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHG    141 - 210
VSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIR    211 - 280
DREAGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKA    281 - 350
PKNADWTTAT                                                                351 - 360
//

Text Mined References (68)

PMID Year Title
26484565 2015 Wnt2 complements Wnt/?-catenin signaling in colorectal cancer.
26116230 2015 Metformin regulates stromal-epithelial cells communication via Wnt2/?-catenin signaling in endometriosis.
25731618 2015 Wnt2 protein plays a role in the progression of pancreatic cancer promoted by pancreatic stellate cells.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
23815780 2013 Frizzled-8 receptor is activated by the Wnt-2 ligand in non-small cell lung cancer.
23694962 2013 DNA methylation biomarkers for noninvasive diagnosis of colorectal cancer.
23610556 2013 A positive feedback loop involving Gcm1 and Fzd5 directs chorionic branching morphogenesis in the placenta.
23603171 2013 The expressions of Wnt/?-catenin pathway-related components in brainstem gliomas.
23322712 2013 Association of Wnt2 and sFRP4 expression in the third trimester placenta in women with severe preeclampsia.
23268410 2012 [Role of Wnt 2, Wnt 3a and ?-catenin in skin lesions of patients with scleroderma].
22949635 2012 Wnt ligands signal in a cooperative manner to promote foregut organogenesis.
22872573 2012 Genome-wide association study of prognosis in advanced non-small cell lung cancer patients receiving platinum-based chemotherapy.
22763454 2012 RNA sequencing of pancreatic circulating tumour cells implicates WNT signalling in metastasis.
22522212 The WNT2 gene polymorphism associated with speech delay inherent to autism.
22489561 2012 WNT2 locus is involved in genetic susceptibility of Peyronie's disease.
22041457 2012 Wnt/?-catenin pathway forms a negative feedback loop during TGF-?1 induced human normal skin fibroblast-to-myofibroblast transition.
21732829 2011 Wnt signaling and Dupuytren's disease.
21575668 2011 Association study of the CNS patterning genes and autism in Han Chinese in Taiwan.
21474991 2011 WNT2 promoter methylation in human placenta is associated with low birthweight percentile in the neonate.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20492734 2010 No association between polymorphisms of WNT2 and schizophrenia in a Korean population.
20018874 2010 Wnt2 regulates progenitor proliferation in the developing ventral midbrain.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19895723 2010 Association between autism and variants in the wingless-type MMTV integration site family member 2 ( WNT2) gene.
19857041 2010 Aberrant changes of Wnt2/beta-catenin signaling pathway induced by sodium nitroprusside in human esophageal squamous cell carcinoma cell lines.
19734317 2009 Mesenchymal stem cells produce Wnt isoforms and TGF-beta1 that mediate proliferation and procollagen expression by lung fibroblasts.
19666519 2009 GATA6 mutations cause human cardiac outflow tract defects by disrupting semaphorin-plexin signaling.
19444628 2009 Wnt2 acts as an angiogenic growth factor for non-sinusoidal endothelial cells and inhibits expression of stanniocalcin-1.
19421142 2009 The Wnt receptor FZD1 mediates chemoresistance in neuroblastoma through activation of the Wnt/beta-catenin pathway.
19239325 2009 Overexpression of Wnt-2 in colorectal cancers.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
19038973 2009 Identification of WNT/beta-CATENIN signaling pathway components in human cumulus cells.
18949017 2009 Downregulation of Wnt2 and beta-catenin by siRNA suppresses malignant glioma cell growth.
18703315 2008 Immunohistochemical profiling of Wnt, NF-kappaB, Stat3 and Notch signaling in human epidermal tumors.
18600204 2008 Overexpression of WNT2 and TSG101 genes in colorectal carcinoma.
18184402 2007 Expression of seven gastric cancer-associated genes and its relevance for Wnt, NF-kappaB and Stat3 signaling.
17948129 2007 Derivation of sarcomas from mesenchymal stem cells via inactivation of the Wnt pathway.
17534895 2007 Inhibition of Wnt-2 and galectin-3 synergistically destabilizes beta-catenin and induces apoptosis in human colorectal cancer cells.
17386109 2007 Regulation of norrin receptor frizzled-4 by Wnt2 in colon-derived cells.
16407829 2006 Alterations of the Wnt signaling pathway during the neoplastic progression of Barrett's esophagus.
16258938 2006 Expression patterns of Wnt genes during development of an anterior part of the chicken eye.
16132582 2005 Frequent loss of membranous E-cadherin in gastric cancers: A cross-talk with Wnt in determining the fate of beta-catenin.
15900580 2005 Wnt2 as a new therapeutic target in malignant pleural mesothelioma.
15896469 2005 Correlation of Wnt-2 expression and beta-catenin intracellular accumulation in Chinese gastric cancers: relevance with tumour dissemination.
15878915 2005 Substantial changes in gene expression of Wnt, MAPK and TNFalpha pathways induced by TGF-beta1 in cervical cancer cell lines.
15507471 2005 The proinvasive activity of Wnt-2 is mediated through a noncanonical Wnt pathway coupled to GSK-3beta and c-Jun/AP-1 signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15048648 2004 Lack of evidence for an association between WNT2 and RELN polymorphisms and autism.
15040835 2004 Cooperation between TGF-beta and Wnt pathways during chondrocyte and adipocyte differentiation of human marrow stromal cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14533014 2003 WNT2 and human gastrointestinal cancer (review).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12147710 2002 Expression of Wnt ligands and Frizzled receptors in colonic mucosa and in colon carcinoma.
12138115 2002 Frizzled-9 is activated by Wnt-2 and functions in Wnt/beta -catenin signaling.
12063568 2002 Expression of ST7R (ST7-like, ST7L) in normal tissues and cancer.
11840514 2002 No association between the WNT2 gene and autistic disorder.
11712082 2001 Differential regulation of WNT2 and WNT2B expression in human cancer.
11449391 2001 Evidence supporting WNT2 as an autism susceptibility gene.
11290296 2001 Induced repatterning of type XVIII collagen expression in ureter bud from kidney to lung type: association with sonic hedgehog and ectopic surfactant protein C.
10557084 1999 Human frizzled 1 interacts with transforming Wnts to transduce a TCF dependent transcriptional response.
10347172 1999 Interaction of frizzled related protein (FRP) with Wnt ligands and the frizzled receptor suggests alternative mechanisms for FRP inhibition of Wnt signaling.
8168088 1994 Differential expression of human Wnt genes 2, 3, 4, and 7B in human breast cell lines and normal and disease states of human breast tissue.
8167409 1993 Wnt family proteins are secreted and associated with the cell surface.
2971536 1988 Isolation of a human gene with protein sequence similarity to human and murine int-1 and the Drosophila segment polarity mutant wingless.
1846319 1991 A new nomenclature for int-1 and related genes: the Wnt gene family.