Property Summary

NCBI Gene PubMed Count 34
PubMed Score 34.07
PubTator Score 28.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4473 9.7e-07
non primary Sjogren syndrome sicca 840 2.3e-02
Disease Target Count Z-score Confidence
Osteoporosis 259 3.587 1.8
Disease Target Count Z-score Confidence
Coffin-Siris syndrome 17 3.056 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 4.200 9.7e-07
non primary Sjogren syndrome sicca -1.200 2.3e-02

 MGI Phenotype (1)

Gene RIF (22)

PMID Text
26627248 loss of endogenous WNT16 results specifically in cortical bone loss, whereas overexpression of WNT16 surprisingly increases mainly trabecular bone mass.
26584014 Data indicate that WNT16 is critical for positive regulation of both cortical and trabecular bone mass and structure. WNT16-TG mice exhibited significantly higher whole-body areal bone mineral density and bone mineral content.
26256109 Although in vitro studies demonstrated no differences in expressions of wild-type and mutant forms of IDUA and WNT16B proteins, in silico analyses predicts that WNT16 rs2707466 directly abolishes a phosphorylation site, which could cause a deleterious effect on WNT16 protein.
26254351 ALL cells expressing WNT16 are sensitive to endoplasmic reticulum stress, and show enhanced killing after addition of chloroquine.
26100275 MicroRNA-374b Suppresses Proliferation and Promotes Apoptosis in T-cell Lymphoblastic Lymphoma by Repressing AKT1 and Wnt-16
25614285 Describe TGFbeta-Wnt16-Notch signaling conduit in the chondrocyte-like transformation of VSMCs and identify endogenous TGFbeta activity in MGP-null VSMCs as a critical mediator of chondrogenesis.
25306233 Osteoblast-derived WNT16 is a previously unreported key regulator of osteoclastogenesis and fracture susceptibility.
24945404 variants at WNT16 were more strongly related to upper limb-bone mineral density, than to bone mineral density at the other sites.
24185276 Increased translation of WNT16 can thus lead to an increased inhibitory action of WNT16 on canonical WNT signaling.
24082114 Estrogen/progesterone treatment of mature myometrial cells induced expression of WNT11 and WNT16, which remained constitutively elevated in leiomyoma tissues.
23617586 results suggest synergistic effects of WNT16a insertion and the at-risk 'T' allele of TCF7L2 (rs7903146) for elevating the expression of TCF7L2 in human pancreas which may affect the regulation of downstream target genes involved in the development of T2D
23417354 Common missense polymorphisms of the WNT16 gene are associated with bone mineral density at the hip, calcaneal ultrasound and the buckling ratio of the femoral neck, as well as with hip fractures in individuals under 80 years of age.
23074152 Analyses of femoral neck BMD also supported association with SNPs in WNT16 and ESR1/C6orf97
22863786 Treatment-induced damage to the tumor microenvironment promotes prostate cancer therapy resistance through WNT16B.
22792071 These results suggest a critical role of Wnt 16 signaling pathway on cortical bone thickness and bone strength determination as well as fracture susceptibility.
22792070 these findings postulate that the WNT16/C7orf58 locus contains complex patterns of genetic variation, which play an important role in peak bone mass accrual and may likely impact BMD determination at later life.
19951988 study identified WNT16B as a new marker of senescence that regulates p53 activity and the PI3K/AKT pathway and is necessary for the onset of replicative senescence
19863181 Results demonstrated significant up-regulation of WNT-3, WNT-4, WNT-5B, WNT-7B, WNT-9A, WNT-10A, and WNT-16B in patients with CLL compared to normal subjects.
19101069 Wnt16 does not activate canonical Wnt signaling in E2A-PBX1-positive cells. Instead, beta-catenin is involved in N-cadherin-dependent adherence junctions
16769578 Targeted-E2A-PBX1 inhibition leads to reduced expression of the EB-1 and Wnt16b genes; aberrant expression of these genes may be a key step in leukemogenesis in t(1;19)-positive pre-B leukemia.
16007226 Targeted-Wnt16b inhibition leads to apoptotic cell death, and Wnt16b mediates its effect through canonical Wnt pathway involving dishevelled-2, beta-catenin and survivin; Wnt16 plays an important role in leukemogenesis.
15756456 genomic analysis of conserved sequences between human, rat, and zebrafish WNT16

AA Sequence

MDRAALLGLARLCALWAALLVLFPYGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELCKRKPYLLPSI      1 - 70
REGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKETAFIYAVMAAGLVHSVTRSCS     71 - 140
AGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFLDFPIGNTTGKENKVLLAMNLHNNEAGR    141 - 210
QAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKTKRKMRRREKDQRKIPIH    211 - 280
KDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYV    281 - 350
RCRRCESMTDVHTCK                                                           351 - 365
//

Text Mined References (35)

PMID Year Title
26627248 2015 The bone-sparing effects of estrogen and WNT16 are independent of each other.
26584014 2016 Osteoblast-Specific Overexpression of Human WNT16 Increases Both Cortical and Trabecular Bone Mass and Structure in Mice.
26256109 2016 Identification of IDUA and WNT16 Phosphorylation-Related Non-Synonymous Polymorphisms for Bone Mineral Density in Meta-Analyses of Genome-Wide Association Studies.
26254351 2015 WNT16-expressing Acute Lymphoblastic Leukemia Cells are Sensitive to Autophagy Inhibitors after ER Stress Induction.
26100275 2015 MicroRNA-374b Suppresses Proliferation and Promotes Apoptosis in T-cell Lymphoblastic Lymphoma by Repressing AKT1 and Wnt-16.
25614285 2015 Wnt16 attenuates TGF?-induced chondrogenic transformation in vascular smooth muscle.
25306233 2014 Osteoblast-derived WNT16 represses osteoclastogenesis and prevents cortical bone fragility fractures.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24430505 2014 Genetic determinants of heel bone properties: genome-wide association meta-analysis and replication in the GEFOS/GENOMOS consortium.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
24185276 2014 Variation in the Kozak sequence of WNT16 results in an increased translation and is associated with osteoporosis related parameters.
24082114 2013 Paracrine activation of WNT/?-catenin pathway in uterine leiomyoma stem cells promotes tumor growth.
23617586 2013 Carriers of a novel frame-shift insertion in WNT16a possess elevated pancreatic expression of TCF7L2.
23417354 2013 Missense polymorphisms of the WNT16 gene are associated with bone mass, hip geometry and fractures.
23074152 2013 Meta-analysis of genome-wide studies identifies WNT16 and ESR1 SNPs associated with bone mineral density in premenopausal women.
22863786 2012 Treatment-induced damage to the tumor microenvironment promotes prostate cancer therapy resistance through WNT16B.
22792071 2012 WNT16 influences bone mineral density, cortical bone thickness, bone strength, and osteoporotic fracture risk.
22792070 2012 Meta-analysis of genome-wide scans for total body BMD in children and adults reveals allelic heterogeneity and age-specific effects at the WNT16 locus.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
19951988 2009 WNT16B is a new marker of cellular senescence that regulates p53 activity and the phosphoinositide 3-kinase/AKT pathway.
19863181 2009 Variation in WNT genes expression in different subtypes of chronic lymphocytic leukemia.
19101069 2009 beta-catenin is involved in N-cadherin-dependent adhesion, but not in canonical Wnt signaling in E2A-PBX1-positive B acute lymphoblastic leukemia cells.
17200136 2007 Role for WNT16B in human epidermal keratinocyte proliferation and differentiation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16808837 2006 Wnt expression and canonical Wnt signaling in human bone marrow B lymphopoiesis.
16769578 2006 The effects of siRNA-mediated inhibition of E2A-PBX1 on EB-1 and Wnt16b expression in the 697 pre-B leukemia cell line.
16258938 2006 Expression patterns of Wnt genes during development of an anterior part of the chicken eye.
16007226 2005 Inhibition of Wnt16 in human acute lymphoblastoid leukemia cells containing the t(1;19) translocation induces apoptosis.
15756456 2005 Comparative genomics on Wnt16 orthologs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11095990 2000 Wnt-16a, a novel Wnt-16 isoform, which shows differential expression in adult human tissues.
10500199 1999 Oncogenic homeodomain transcription factor E2A-Pbx1 activates a novel WNT gene in pre-B acute lymphoblastoid leukemia.
8167409 1993 Wnt family proteins are secreted and associated with the cell surface.