Property Summary

NCBI Gene PubMed Count 36
PubMed Score 113.71
PubTator Score 56.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer 1.800 7.2e-06
posterior fossa group A ependymoma 1.300 1.0e-03
ductal carcinoma in situ -1.300 4.3e-02
invasive ductal carcinoma -1.400 2.0e-02
Breast cancer 1.100 4.1e-02

 GWAS Trait (1)

 CSPA Cell Line (1)

Gene RIF (28)

PMID Text
27386628 Demonstrate immunohistochemical expression of Wnt11 and BCL2A1 in complete moles and normal villi.
26818191 The Wnt11 gene plays an important role in human mesenchymal stromal cells for enhancing the osteogenesis in an infectious environment.
26261605 Report high expression of Wnt11 in esophageal squamous cell carcinoma, which was significantly associated with AJCC stage.
24737009 High expression of Wnt-11 is associated with metastasis in cervical cancer.
24606488 differential Wnt11 immunoexpression in high-grade human serous ovarian cancer compared to low-grade human serous ovarian cancer could play important roles in serous ovarian cancer progression and may be modulated by Wnt5a expression levels.
24082114 Estrogen/progesterone treatment of mature myometrial cells induced expression of WNT11 and WNT16, which remained constitutively elevated in leiomyoma tissues.
23549873 Data established a seven-gene (AR, ESR2, GATA3, GBX2, KRT16, MMP28 and WNT11) prognostic signature to define a subset of triple-negative breast cancer (TNBC).
22715413 Notch1-induced WISP-1 expression appeared to be Wnt11-dependent, but Wnt1-independent
22161723 Wnt11 mRNA expression was significantly higher in the stage I, II, III, or IV colorectal tumor tissues than in non-tumor colon.
21903761 Wnt11 is involved in the protection of the host intestinal cells by blocking the invasion of pathogenic bacteria, suppressing inflammation, and inhibiting apoptosis.
21280163 These observations highlight the distinct roles of WNT11 and WNT4 during the early stages of retinoic acid-induced neuronal differentiation.
21242973 WNT11 emerged as a direct target of ERG.
20890934 Observational study of gene-disease association. (HuGE Navigator)
20870744 Data provide evidence for an autocrine regulatory loop involving transcriptional upregulation of WNT11 by ERRalpha and beta-cat that influences the migratory capacity of cancer cells.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20219091 These observations suggest that the increased level of Wnt-11 found in prostate cancer contributes to tumour progression by promoting neuroendocrine-like differentiation.
20103596 These observations suggest a novel role for Wnt11 as a tumor suppressor during hepatocarcinogenesis because loss of expression promotes the malignant phenotype via both canonical and noncanonical Wnt signaling pathways.
20062060 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19265664 Our study reveals an unappreciated role for noncanonical Wnt signaling in hESC specification that involves development of unique mesoderm precursors via morphogenic organization within human EBs.
18572162 Wnt-11 promotes cell viability and is involved in coordination of key signaling pathways.
18413325 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17967789 Wnt5a and Wnt11 expression in EPC cells was induced by coculture with rat neonatal cardiomyocyte and was blocked by gamma-secretase inhibition.
15708567 Wnt11 gene is expressed during early embryonic development and has a critical role in regulation of gastrulation movements.
15701629 Wnt11 promotes cardiac differentiation via the non-canonical PKC-dependent signaling pathway
15084607 Wnt11 stimulates proliferation, migration, cytoskeletal rearrangement, and contact-independent growth by a beta-catenin-independent mechanism
11712081 WNT11 mRNA was up-regulated in four cases of colorectal adenocarcinoma, and a case of renal cell carcinoma. Up-regulation of WNT11 mRNA might play an important role in human carcinogenesis through activation of the WNT signaling pathway.

AA Sequence

MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCRSNLELMHTVV      1 - 70
HAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAAAISHAIARACTSGDLPGCSC     71 - 140
GPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLEMKCK    141 - 210
CHGVSGSCSIRTCWKGLQELQDVAADLKTRYLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSP    211 - 280
DFCMKNEKVGSHGTQDRQCNKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVER    281 - 350
YVCK                                                                      351 - 354
//

Text Mined References (37)

PMID Year Title
27386628 2016 Immunohistochemical Expression and Clinical Significance of Wnt11 and BCL2A1 in Complete Moles.
26818191 2016 Wnt11 plays an important role in the osteogenesis of human mesenchymal stem cells in a PHA/FN/ALG composite scaffold: possible treatment for infected bone defect.
26261605 2015 Expression of Wnt11 and Rock2 protein with clinical characteristics of esophageal squamous cell carcinoma in Kazakh and Han patients.
25416956 2014 A proteome-scale map of the human interactome network.
24737009 2014 Clinical significance of Wnt-11 and squamous cell carcinoma antigen expression in cervical cancer.
24606488 2014 Differential Wnt11 expression related to Wnt5a in high- and low-grade serous ovarian cancer: implications for migration, adhesion and survival.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24082114 2013 Paracrine activation of WNT/?-catenin pathway in uterine leiomyoma stem cells promotes tumor growth.
23549873 2013 Identification of prognosis-relevant subgroups in patients with chemoresistant triple-negative breast cancer.
22715413 2012 Inhibition of fibroblast growth by Notch1 signaling is mediated by induction of Wnt11-dependent WISP-1.
22161723 2013 Possible involvement of Wnt11 in colorectal cancer progression.
21903761 2011 Wingless homolog Wnt11 suppresses bacterial invasion and inflammation in intestinal epithelial cells.
21280163 2011 Distinct roles for Wnt-4 and Wnt-11 during retinoic acid-induced neuronal differentiation.
21242973 2011 Genome-wide screen reveals WNT11, a non-canonical WNT gene, as a direct target of ETS transcription factor ERG.
20890934 2010 Studies with Wnt genes and nonsyndromic cleft lip and palate.
20870744 2010 WNT11 expression is induced by estrogen-related receptor alpha and beta-catenin and acts in an autocrine manner to increase cancer cell migration.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20219091 2010 Wnt-11 promotes neuroendocrine-like differentiation, survival and migration of prostate cancer cells.
20103596 2010 Noncanonical Wnt11 inhibits hepatocellular carcinoma cell proliferation and migration.
20062060 2010 Genome-wide association study of PR interval.
19847889 2010 SUZ12 is a candidate target of the non-canonical WNT pathway in the progression of chronic myeloid leukemia.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19265664 2009 Noncanonical Wnt signaling orchestrates early developmental events toward hematopoietic cell fate from human embryonic stem cells.
18572162 2008 Wnt-11 signaling leads to down-regulation of the Wnt/beta-catenin, JNK/AP-1 and NF-kappaB pathways and promotes viability in the CHO-K1 cells.
18413325 2008 Variation in WNT genes is associated with non-syndromic cleft lip with or without cleft palate.
17967789 2007 Notch signaling contributes to the expression of cardiac markers in human circulating progenitor cells.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15708567 2005 Wnt11-R, a protein closely related to mammalian Wnt11, is required for heart morphogenesis in Xenopus.
15701629 2005 Non-canonical Wnt signaling enhances differentiation of human circulating progenitor cells to cardiomyogenic cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15084607 2004 Wnt11 signaling promotes proliferation, transformation, and migration of IEC6 intestinal epithelial cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11712081 2001 Molecular cloning and characterization of human WNT11.
9757009 1998 Isolation, characterisation and embryonic expression of WNT11, a gene which maps to 11q13.5 and has possible roles in the development of skeleton, kidney and lung.
8167409 1993 Wnt family proteins are secreted and associated with the cell surface.