Property Summary

NCBI Gene PubMed Count 40
PubMed Score 121.87
PubTator Score 56.14

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.100 4.1e-02
colon cancer 1.800 7.2e-06
ductal carcinoma in situ -1.300 4.3e-02
invasive ductal carcinoma -1.400 2.0e-02
posterior fossa group A ependymoma 1.300 1.0e-03

 GWAS Trait (1)

 CSPA Cell Line (1)

Protein-protein Interaction (2)

Gene RIF (32)

AA Sequence

MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCRSNLELMHTVV      1 - 70
HAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAAAISHAIARACTSGDLPGCSC     71 - 140
GPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLEMKCK    141 - 210
CHGVSGSCSIRTCWKGLQELQDVAADLKTRYLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSP    211 - 280
DFCMKNEKVGSHGTQDRQCNKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVER    281 - 350
YVCK                                                                      351 - 354
//

Text Mined References (41)

PMID Year Title