Property Summary

NCBI Gene PubMed Count 41
PubMed Score 380.48
PubTator Score 85.64

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (13)

Gene RIF (34)

PMID Text
26049155 WNT10A exonic variant increases the risk of keratoconus by decreasing corneal thickness
25795715 High WNT10A expression promotes an invasive and self-renewing phenotype in esophageal squamous cell carcinoma
25612571 this study demonstrated that common variations in WNT10A have pleiotropic effects on the morphology of ectodermal appendages.
25545742 p.Arg113Cys, p.Phe228Ile, newly identified p.Arg171Leu may represent aetiological mutations underlying MLIA w/associated dental anomalies, implicating coding variants in WNT10A gene
25134734 WNT10A promotes the proliferation of DPCs and negatively regulates their odontoblastic differentiation.
25054240 WNT10A may induce kidney fibrosis and associate with kidney dysfunction in acute interstitial nephritis.
24957471 transmission disequilibrium test showed transmitted disequilibrium in C392T. we found an association between the C392T variant and nonsyndromic oral clefts.
24798981 The novel c.-14_7delinsC mutation might be the etiological variant of the WNT10A gene responsible for the permanent tooth agenesis in the Egyptian family.
24700731 Patients with bi-allelic WNT10A mutations have severe tooth agenesis.
24554542 involvement of PAX9, EDA, SPRY2, SPRY4, and WNT10A as risk factors for MLIA. uncovered 3 strong synergistic interactions between MLIA liability and MSX1-TGFA, AXIN2-TGFA, and SPRY2-SPRY4 gene pairs. 1st evidence of sprouty genes in MLIA susceptibility.
24458874 Barrel-shaped mandibular incisors and severe hypodontia appear to be associated with homozygous or compound heterozygous mutations of WNT10A.
24449199 WNT10A mutations account for (1/4) of population-based isolated oligodontia and show phenotypic correlations.
24312213 WNT10A and EDA digenic mutations could result in oligodontia and syndromic tooth agenesis in the Chinese population. Moreover, our results will greatly expand the genotypic spectrum of tooth agenesis.
24311251 Our study has demonstrated for the first time that agenesis of the maxillary permanent canines is a distinct entity, associated with mutations in WNT10A.
24043634 WNT10A variants were associated with non-syndromic tooth agenesis from mild to severe tooth agenesis, and the more severe tooth agenesis, the stronger association.
23401279 Mutations in WNT10A are frequently involved in oligodontia associated with minor signs of ectodermal dysplasia.
23358095 Expression studies in human hair follicle tissue suggests that WNT10A has a functional role in androgenetic alopecia etiology.
23167694 Nine pathogenic mutations within the coding region of the WNT10A gene were identified in 26 out of 42 (62%) Polish patients with non-syndromic tooth agenesis.
23135473 the expression level of Wnt10a is higher in endometrioid carcinoma than in non-endometrioid subtypes; however, the underlying mechanism remains unclear.
23094073 WNT10A acts as an autocrine oncogene both in renal cell carcinoma carcinogenesis and progression by activating WNT/beta-catenin signaling.
22581971 In a panel of 34 patients with isolated hypodontia, the candidate gene WNT10A and the genes MSX1, PAX9, IRF6 and AXIN2 have been sequenced. WNT10A mutations were identified in 56% of the cases with non-syndromic hypodontia.
21547848 We observed a marginally significant interaction between WNT10 rs10177996 (intron 1) and an individual's proportion of calories from saturated fat.
21279306 Case Reports: Single pedigree study provides a detailed illustration of the phenotypic spectrum of ectodermal abnormalities associated with WNT10A gene pathology.
21203463 WNT10A may be a novel angio/stromagenic growth factor
21143469 Mutations in the WNT10A gene are associated with ectodermal dysplasia presenting as palmoplantar keratoderma in two families.
20979233 patients harboring WNT10A mutations displayed distinctive clinical features (marked dental phenotype, no facial dysmorphism)
20585627 Observational study of gene-disease association. (HuGE Navigator)
19863181 Results demonstrated significant up-regulation of WNT-3, WNT-4, WNT-5B, WNT-7B, WNT-9A, WNT-10A, and WNT-16B in patients with CLL compared to normal subjects.
19559398 Study reports on 12 patients, from 11 unrelated families, with ectodermal dysplasia caused by five previously undescribed WNT10A mutations
19471313 The first inherited missense mutation in WNT10A with associated ectodermal features, is reported.
19453261 Observational study of gene-disease association. (HuGE Navigator)
18787224 mantle cell lymphoma highly and consistently expressed Wnt3 and Wnt10.
17847007 c.697G-->T (p.Glu233X) homozygous nonsense mutation in exon 3 of the WNT10A gene in an autosomal recessive ectodermal dysplasia: odonto-onycho-dermal dysplasia
16953426 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSAHPRPWLRLRPQPQPRPALWVLLFFLLLLAAAMPRSAPNDILDLRLPPEPVLNANTVCLTLPGLSRR      1 - 70
QMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYESPIFSRGFRESAFAYAIAAAG     71 - 140
VVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLDALQRGKGLSHGVPEHPALPTASPGLQDSWE    141 - 210
WGGCSPDMGFGERFSKDFLDSREPHRDIHARMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVT    211 - 280
PEFRTVGALLRSRFHRATLIRPHNRNGGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREP    281 - 350
RLDSAGTVGRLCNKSSAGSDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK       351 - 417
//

Text Mined References (43)

PMID Year Title
26049155 2015 WNT10A exonic variant increases the risk of keratoconus by decreasing corneal thickness.
25795715 2015 WNT10A promotes an invasive and self-renewing phenotype in esophageal squamous cell carcinoma.
25612571 2015 Common polymorphisms in WNT10A affect tooth morphology as well as hair shape.
25545742 2015 WNT10A coding variants and maxillary lateral incisor agenesis with associated dental anomalies.
25134734 2014 Effects of WNT10A on proliferation and differentiation of human dental pulp cells.
25054240 2014 Role of WNT10A-expressing kidney fibroblasts in acute interstitial nephritis.
24957471 2014 C392T polymorphism of the Wnt10a gene in non-syndromic oral cleft in a northeastern Chinese population.
24798981 2014 A novel WNT10A mutation causes non-syndromic hypodontia in an Egyptian family.
24700731 2014 The WNT10A gene in ectodermal dysplasias and selective tooth agenesis.
24554542 2014 Identification of genetic risk factors for maxillary lateral incisor agenesis.
24458874 2014 Tricho-odonto-onycho-dermal dysplasia and WNT10A mutations.
24449199 2014 WNT10A mutations account for ¼ of population-based isolated oligodontia and show phenotypic correlations.
24312213 2013 Involvement of and interaction between WNT10A and EDA mutations in tooth agenesis cases in the Chinese population.
24311251 2014 WNT10A mutations also associated with agenesis of the maxillary permanent canines, a separate entity.
24043634 2014 WNT10A variants are associated with non-syndromic tooth agenesis in the general population.
23401279 2013 Mutations in WNT10A are frequently involved in oligodontia associated with minor signs of ectodermal dysplasia.
23358095 2013 Androgenetic alopecia: identification of four genetic risk loci and evidence for the contribution of WNT signaling to its etiology.
23167694 2013 Nucleotide variants of genes encoding components of the Wnt signalling pathway and the risk of non-syndromic tooth agenesis.
23135473 2013 Expression and the clinical significance of Wnt10a and Wnt10b in endometrial cancer are associated with the Wnt/?-catenin pathway.
23094073 2012 WNT10A plays an oncogenic role in renal cell carcinoma by activating WNT/?-catenin pathway.
22581971 2012 Mutations in WNT10A are present in more than half of isolated hypodontia cases.
21547848 2011 Polymorphisms in WNT6 and WNT10A and colorectal adenoma risk.
21484994 2011 WNT10A and isolated hypodontia.
21279306 2011 Intra-familial variability of ectodermal defects associated with WNT10A mutations.
21203463 2010 Circadian disruption accelerates tumor growth and angio/stromagenesis through a Wnt signaling pathway.
21143469 2011 Two families confirm Schöpf-Schulz-Passarge syndrome as a discrete entity within the WNT10A phenotypic spectrum.
20979233 2011 Only four genes (EDA1, EDAR, EDARADD, and WNT10A) account for 90% of hypohidrotic/anhidrotic ectodermal dysplasia cases.
20585627 2010 Web-based, participant-driven studies yield novel genetic associations for common traits.
20163410 2010 Phenotypic variability associated with WNT10A nonsense mutations.
19896111 2009 Common variants in the trichohyalin gene are associated with straight hair in Europeans.
19863181 2009 Variation in WNT genes expression in different subtypes of chronic lymphocytic leukemia.
19559398 2009 WNT10A mutations are a frequent cause of a broad spectrum of ectodermal dysplasias with sex-biased manifestation pattern in heterozygotes.
19471313 2009 WNT10A missense mutation associated with a complete odonto-onycho-dermal dysplasia syndrome.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
18787224 2008 Constitutive activation of the Wnt canonical pathway in mantle cell lymphoma.
17847007 2007 Mutation in WNT10A is associated with an autosomal recessive ectodermal dysplasia: the odonto-onycho-dermal dysplasia.
16953426 2006 Analysis of candidate genes on chromosome 2 in oral cleft case-parent trios from three populations.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15040835 2004 Cooperation between TGF-beta and Wnt pathways during chondrocyte and adipocyte differentiation of human marrow stromal cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11350055 2001 WNT10A and WNT6, clustered in human chromosome 2q35 region with head-to-tail manner, are strongly coexpressed in SW480 cells.