Property Summary

NCBI Gene PubMed Count 172
PubMed Score 492.73
PubTator Score 347.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (147)

PMID Text
26707142 our results suggest that miR-148a can suppress the migration and invasion of breast cancer cells by targeting WNT-1 and inhibiting Wnt/beta-catenin signaling pathway and this will provide new insights into the molecular mechanisms of breast cancer metastasis
26592459 Studies indicate crosstalk between Notch receptor and Wnt protein, Hedgehog protein, hypoxia and transforming growth factor beta (TGFbeta)/bone morphogenetic protein (BMP) pathways.
26499380 High expression of WNT1 is associated with liver cancer.
26450645 IWR-1 has the potential to suppress tumor metastasis by inhibiting Wnt/beta-catenin pathway as well as survivin expression
26421711 MCF7 cells over-expressing both WNT1 and FGF3 show a 3.5-fold increase in mammosphere formation; conditioned media from these cells also promotes stem cell activity in untransfected parental MCF7 and T47D cells, as WNT1 and FGF3 are secreted factors.
26261683 Suggest that TGF-beta1/Smad and Wnt/CTNNB1 signaling pathways both contribute to pathological scar formation.
26214410 Results suggested that Wnt1-induced MAFK expression promoted cell proliferation in MG63 cells, and that the role of MAFK in osteosarcoma might be closely linked to the Wnt signaling pathway.
25909283 Data suggest that fibulin-5 functions as a metastasis suppressor in lung cancer by modulating tumor microenvironment to suppress Wnt/beta-catenin signaling.
25721714 Wnt1 promotes CD36 expression via activation of PPAR-gamma and TCF4.
25677507 Agonists of epoxyeicosatrienoic acids reduce infarct size and ameliorate cardiac dysfunction via activation of HO-1 and Wnt1 canonical pathway.
25627001 WNT1 was a direct target of miR-148b, and overexpressed WNT1 inversely correlated with miR-148b levels in hepatocellular carcinoma tissues.
25618247 Wnt1 stimulates osteogenic differentiation and mineralization of human periodontal ligament fibroblasts, mainly by activating the canonical Wnt/beta-catenin pathway, in which Runx2 is a key downstream regulator.
25422594 in the absence of retinoid signaling via RARbeta, reduced IGF-1 signaling results in suppression of epithelial-mesenchymal transition and delays tumorigenesis induced by the Wnt1 oncogene
25350852 Paracrine WNT signaling is stimulated by estrogen and progesterone, while autocrine WNT signaling is induced by the embryonic T-box transcription factor TBX3
25197350 Our study suggests that Sox9 siRNA inhibits the proliferation capability of human osteosarcoma cells by down-regulating the expression of Wnt1 and its receptor Fzd1
25143352 Results suggest ivermectin as therapeutic WNT protein-TCF transcription factor pathway response blocker to treat WNT-TCF-dependent diseases including multiple cancers.
25076852 The immunofluorescent staining pattern of Wnt1 and CK7 as well as Wnt1 and CK13 was consistent with IHC results. Thus, in pleomorphic adenoma, Wnt is involved in tumor cell differentiation of peripheral columnar cells forming solid nests
25010833 Bisphosphonate treatment of children with WNT1 mutations was associated with increasing lumbar spine areal bone mineral density z-scores, but the effect was smaller than what had been reported for children with classical osteogenesis imperfecta.
24863942 Data indicate that miR-122 suppressed the activation of Wnt/beta-catenin pathway by targeting WNT1.
24713700 Data indicate that BMVC- and BMVC4-repressed WNT1 gene expression through stabilizing the G-quadruplex structure formed at its promoter.
24659666 The expression levels of WNT1 was found to increase in both cancer stem cells and non- cancer stem cells when cancer stem cells were maintained as spheroids
24499657 WNT/beta-catenin pathway and E-cadherin are important factors in advanced epithelial ovarian cancer.
24481453 Activation of Wnt1 and beta-catenin signaling accelerates the proliferation of gastric cancer stem cells.
24480807 Upregulation of WNT1 is associated with lung cancer invasion.
24416131 These findings provide important evidence that the reduced miR-152 expression by HCV core protein can indirectly lose an inhibitory effect on Wnt1, which might, at least partially lead to cell proliferation of liver cancer cells.
24374807 Identify emilin2 as a key extracellular regulator of the Wnt signalling pathway suppressing breast cancer cell growth and migration.
24305876 FGFR1, WNT, and TGF-beta have roles in signaling of reactive stroma in aggressive prostate adenocarcinomas
24301659 Hypoxic macrophages impair autophagy in epithelial cells through Wnt1.
24067880 In human pancreatic mucinous cystic neoplasms, expression of Wnt1 was detected in focal cyst epithelial cells in the majority of cases. The ovarian-like stroma was diffusely positive for Wnt1 in all of the human MCN cases examined.
24002087 A functional missense variant of WNT1 (rs61758378 resulting in S88R)was overrepresented in autism spectrum disorder patients. Functional analysis revealed that WNT1-S88R is more active than wild-type WNT1 in assays for the Wnt/beta-catenin signaling pathway.
23913826 High WNT1 expression is associated with prostate cancer.
23851184 Wnt-1 is a target of regulation by miR-200b and miR-22.
23708097 alterations of the Wnt1/beta-catenin axis in clear cell renal cell carcinoma (ccRCC) were examined.
23656646 This report identifies human skeletal diseases associated with mutations in WNT1.
23613467 The Wnt1-beta-catenin pathway represses let-7 microRNA expression through transactivation of Lin28 to augment breast cancer stem cell expansion.
23605563 Data indicate that the canonical Wnt/sscatenin signaling pathway appears to trigger amniotic fluid mesenchymal stem cells (huAFMSC) osteoblastogenesis.
23551536 Wnt1 expression in invasive breast tumour cells seems to promote differentiation and apoptosis, while being related inversely to proliferation.
23499310 WNT1 mutations are associated with moderately severe and progressive recessive osteogenesis imperfecta.
23499309 Mutations in WNT1 cause different forms of bone fragility.
23434763 Mutations in WNT1 are a cause of osteogenesis imperfecta.
23379509 Studies indicate that DISC1 and AKT were invlved in the regulation of GSK3beta and Wnt signaling paathway.
23284750 Promoter hypermethylation of WNT gene is associated with Basal Cell Carcinoma.
23152614 HIV-1 Tat-mediated downregulation of beta-catenin/Wnt signaling is dependent on the core and cysteine-rich domains (residues 20-48) of Tat
23152495 Matrix rigidity activates Wnt signaling through down-regulation of Dickkopf-1 protein
23134367 Psychiatric disorder-related behavioral abnormalities are displayed in a neural crest-derived brain region of WNT1/GAL4 double-transgenic mice.
22954590 Findings suggest that Mel-18 is a novel negative regulator of breast cancer stem cell (CSC) that inhibits the stem cell population and in vitro and in vivo self-renewal through the inactivation of Wnt-mediated Notch signaling.
22859293 PDZ-RGS3 can enhance signals generated by the Wnt canonical pathway and plays a pivotal role in epithelial mesenchymal transition
22823957 These results suggest, for the first time, that the Wnt/beta-catenin pathway regulates ABCB1 in CML.
22815884 R-Spondin potentiates Wnt/beta-catenin signaling through orphan receptors LGR4 and LGR5
22696217 peptide derived from the loop 2 region of sclerostin blocked the interaction of sclerostin with LRP5/6 and also inhibited Wnt1 but not Wnt3A or Wnt9B signaling. This suggests that these Wnts interact with LRP6 in different ways
22546285 Studies idicate that NOTCH, BMP4 and WNT pathways are involved in the regulation of intestinal cancer stem cells.
22494971 GSK3beta plays an essential role in Ras degradation and inhibition of this degradation pathway by aberrant Wnt/beta-catenin signaling may contribute to Ras-induced transformation in colorectal tumorigenesis
22406377 Metformin-mediated Bambi expression in hepatic stellate cells induces prosurvival Wnt/beta-catenin signaling
22392999 Wnt/beta-catenin signaling promotes differentiation, not self-renewal, of human embryonic stem cells and is repressed by Oct4
22391424 This study establishes an association between low Wnt-1 and high Dkk-1 serum levels and premature myocardial infarction
22388478 Erythropoietin prevents beta-amyloid degeneration of microglia via Wnt1/PI 3-K/mTOR/Bad/Bcl-xL pathway.
22351518 Epigenetic silencing of sFRP1 activates the canonical Wnt pathway and contributes to increased cell growth and proliferation in hepatocellular carcinoma
22270359 Leptin-induced epithelial-mesenchymal transition in breast cancer cells requires beta-catenin activation via Akt/GSK3- and MTA1/Wnt1 protein-dependent pathways.
22139084 Data indicate that CDH11 as a functional tumor suppressor and an important antagonist of Wnt/beta-catenin signaling, with frequent epigenetic inactivation in common carcinomas.
22123293 Studies indicate that pathways of Hedgehog (Hh), Wnt and Notch, which regulate development during embryonic life and somatic stem cells (SCs) in the adult organism, can be reactivated in malignancies and support tumor-initiating cells (TIC) scompartment.
22117039 One mechanism through which canonical Wnt signaling could shape niches supportive of hematopoiesis.
21971039 a connection between Wnt1 signaling and the transcriptional regulation of neurodegenerative disease genes
21858154 Data suggest that VDR controls the level of nuclear beta-catenin in colon cancer cells and can therefore attenuate the impact of oncogenic mutations that activate the Wnt/beta-catenin pathway.
21851818 Interplay of Wnt and c-MYC signaling during intestinal homeostasis and transformation.
21781302 Data suggest that PL suppresses tumor growth, invasion, and angiogenesis through the inhibition of Wnt/beta-catenin signaling in certain colon cancer cells.
21680704 BR-DIM and CDF inhibited the signal transduction in the AR/TMPRSS2-ERG/Wnt signaling network, leading to the inactivation of Wnt signaling consistent with inhibition of prostate cancer cell invasion
21678109 Abnormal expression of E-cadherin, beta-catenin, Wnt-1 was observed.
21505183 PDE5 inhibition by sulindac sulfide selectively induces apoptosis and attenuates oncogenic Wnt/beta-catenin-mediated transcription in human breast tumor cells
21344486 WNT1 and SFRP1 mRNA levels were higher in DU145 cells compared to non-osteotropic cells.
21336184 High Wnt1 is associated with non-small cell lung cancer after surgery.
21321190 These findings demonstrate that Wnt1 is a novel angiogenic protein that is expressed in developing endothelial cells and can be therapeutically deployed to increase blood flow and angiogenesis.
21317455 Novel insights into roles for DKK1 in addition to canonical WNT signaling and the mechanism of colon cancer initiating cells transformation.
21259057 the aim of this study was to investigate the prognosis and clinicopathologic roles of beta-catenin, Wnt1, Smad4, Hoxa9, and Bmi-1 in esophageal squamous cell carcinoma
21044957 TMEM88 associates with Dvl proteins and regulates Wnt signaling in a context-dependent manner
20865400 Wnt-1 regulates IL-1beta-mediated HIF-1alpha induction via NF-kappaB.
20809334 The protein expression levels of Wnt1, beta-catenin and Cyclin D1 were all positively correlated with the Karnofsky performance scale (KPS) score and World Health Organization (WHO) grades of patients with gliomas.
20664938 Intratumoral Wnt1 overexpression could produce more aggressive NSCLCs by induction of survivin.
20564229 Data indicate involvement of canonical Wnt signaling and link between the Wnt pathway and chromatin regulation in epithelial stem cells.
20491588 Overexpression of Wnt1/beta-catenin might predict the clinicopathologic stage and prognosis of esophageal squamous cell carcinoma (ESCC) and the level of Wnt1/beta-catenin mRNA was conversely correlated with lymph node metastasis and advanced disease.
20334650 the WIF-1 gene is frequently down-regulated or silenced in astrocytomas by aberrant promoter methylation
19956832 activation of the Wnt pathway is associated with high proliferation, dedifferentiation and a solid morphology in biliary tract cancer
19956716 Mutations in the human naked cuticle homolog NKD1 found in colorectal cancer alter Wnt/Dvl/beta-catenin signaling
19924227 the beta-catenin-dependent Wnt pathway is integrated with integrin signaling through the adaptor molecule Grb2
19885602 procaine and procainamide reactivate WIF-1 in lung cancer cells and downregulate the Wnt canonical pathway
19781444 SALL4 plays a critical role in the pathogenesis of MDS by causing the aberrant activation of the Wnt/beta-catenin pathway.
19778454 Results suggest that the blockade of Wnt-1-mediated signaling may offer a potential pathway-specific therapeutic strategy for the treatment of a subgroup of HCC that over-expresses Wnt-1.
19756656 Activated embryonal development-related wnt1/beta-catenin pathway might take part in the oncogenesis and growth of neural crest-derived neuroblastoma.
19734317 These data demonstrate that mesenchymal stem cells from mice and humans produce Wnt proteins and TGF-beta1 that respectively stimulate lung fibroblast proliferation and matrix production.
19729480 HMGA1 is involved in proliferation and gastric tumor formation via the Wnt/beta-catenin pathway.
19711366 PPP(S/T)P motif phosphorylation of the free LRP6 intracellular domain is not required to activate the Wnt/beta-catenin pathway and attenuate GSK3beta activity
19693690 CDK5-splicing variant might also be a negative regulator of Wnt/beta-catenin signaling pathway.
19628668 Ectopic expression of either Wnt1 or stabilized beta-catenin in vitro induced the transcription factor Snail and suppressed nephrin expression, leading to podocyte dysfunction
19473496 WNT signaling enhances breast cancer cell motility and blockade of the WNT pathway by sFRP1 suppresses MDA-MB-231 xenograft growth
19453261 Observational study of gene-disease association. (HuGE Navigator)
19448422 Wnt/beta-catenin signaling pathway may be activated abnormally in some nasopharyngeal carcinoma (NPC) patients. beta-catenin may be a prognostic factor of NPC.
19401692 Activation of Wnt/beta-catenin signalling pathway induces chemoresistance to IFN-alpha/5-FU therapy.
19398721 the 3' untranslated regions of WNT1 and JAG1 were functional targets of miR-34a and miR-21 and provide evidence that these targets were translationally suppressed
19349579 Wnt1 and Wnt signaling have an important role in human mesenchymal stem cell osteogenesis.
19148501 WNT1 was overexpressed in ovarian carcinoma
19061838 analysis of Wnt/beta-catenin and Myc signaling in liver cancer
18936100 Dpr1 negatively modulates the basal activity of Wnt1/beta-catenin signaling in the nucleus by keeping LEF1 in the repressive state.
18844223 adenomatous polyposis coli gene and nuclear b-catenin may have roles in wnt-related progression of invasive urothelial carcinomas
18838960 propose that cytoplasmic stabilization of beta-catenin through palmitoylation of Wnt-1 and subsequent activation of the pathway is a potential mechanism of FASN oncogenicity in prostate cancer
18824543 ER stress causes dissociation between GRP78/BiP and Wnt, an interaction essential for its correct posttranslational processing
18790633 The Wnt1 overexpression is associated with the expression of tumour-associated Wnt-targets, tumour proliferation, angiogenesis and a poor prognosis in NSCLCs.
18769117 HDAC3 overexpression alters the epigenetic programming of colon cancer cells to impact intracellular Wnt signaling and their sensitivity to external growth regulation by vitamin D
18769115 RCK/ p54 might be a determinant of colorectal cancer proliferation by activating the canonical Wnt pathway
18705344 In the gastric cancerous tissues, the expression percentage of Wnt-1, beta-catenin and E-cadherin is 54.4%, 45.6%, 47.2%, respectively, which is significantly higher than the percentage expression of these genes in normal tissues (p<0.01).
18676739 the Wnt/beta-catenin pathway contributes to carcinogenesis and cancer cell survival by driving expression of OPG
18593917 HIF-1alpha was found to inactivate the Wnt signaling by binding to hARD1 or beta-catenin, which may contribute to the hypoxia-induced growth arrest of tumor cells.
18469861 A positive feedback stimulation of the Wnt pathway by activation of snail.
18461473 direct binding of NF-kappaB-p50 to the Wnt-1 promoter
18297060 MesP1 drives vertebrate cardiovascular differentiation through Dkk-1-mediated blockade of Wnt-signalling
18218837 Wnt-1 strongly induced the expression of matricellular protein osteopontin, and modestly enhanced the expression of type I collagen in DPSCs. Unexpectedly, Wnt-1 inhibited alkaline phosphatase activity and the formation of mineralized nodules in DPSCs.
18187620 Knockdown of wingless-type MMTV integration site family, member 1 (WNT1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18097596 Wnt1 overexpression affects the tumor proliferation in NSCLCs, partly via the upregulation of c-Myc
18059186 Silencing of WNT1 by siRNA induces apoptosis of MCF-7 human breast cancer cells.
18056036 vascular Bmp Msx2 Wnt signaling and oxidative stress have roles in arterial calcification [review]
17947472 Wnt and epidermal growth factor receptor signaling pathways are altered through aberrant methylation and mutation in non small cell lung cancer
17875805 importance of canonical Wnt signaling to mediate development of early hematoendothelial progenitors during human development
17306035 Wnt1 signaling inhibits interfollicular progenitor cell growth and promotes terminal differentiation of keratinocytes.
17289346 Wnt1 is critical for protection in the SH-SY5Y neuronal cell line against genomic DNA degradation, membrane phosphatidylserine (PS) exposure, and microglial activation.
17143299 Wnt/beta-catenin signaling has a role in neurodevelopment as well as in neurodegenerative diseases [review]
17072303 The identification of a beta-catenin-T-cell factor-regulated Axin2-GSK3beta-Snail1 axis provides new mechanistic insights into cancer-associated epithelial-mesenchymal transition programmes.
17035233 sFRP-1, a target gene of the hedgehog pathway, is involved in cross-talk between the hedgehog pathway and the Wnt pathway
16930536 Wnt signaling activation significantly decreases the viability of retinoblastoma cell lines by inducing cell cycle arrest, which was associated with upregulated p53
16760136 beta-catenin level depends on the way and level of Wnt pathway activation
16756720 Wnt/beta-catenin activation was observed in 65% of pancreatic adenocarcinomas, independently of beta-catenin gene mutations in most tumors
16565090 the MED12 interface within Mediator is a new component in the Wnt/beta-catenin pathway
16501043 increased Wnt signaling, as achieved by ectopic expression of Wnt-1, triggers the DNA damage response and an ensuing cascade of events resulting in tumorigenic conversion of primary breast epithelial cells
16495219 EGCG blocks Wnt signaling by inducing the HBP1 transcriptional repressor and inhibits aspects of invasive breast cancer
16474850 hAR is a direct target of LEF-1/TCF transcriptional regulation in PCa cells; expression of the hAR protein is suppressed by a degradation pathway regulated by cross-talk of Wnt, Akt, and PP2A
16427602 aberrant Wnt signaling is a common event in NPC carcinogenesis linked with WIF-1 silencing
16329837 Wnt-1, beta-catenin and APC expressions were related to the differentiation of oral squamous cell carcinoma.
15913453 Wnt-1 blockade by either monoclonal antibody or siRNA induces cell death in sarcoma cells
15841445 HCV core protein induces Huh-7 cell proliferation whether alone or in the context of HCV replication, which is at least partly mediated by transcriptional upregulation of growth-related genes, in particular wnt-1
15824740 Causal relationship exists between aberrant Wnt-1 signaling and estrogen receptor+ mammary tumors
15580286 Oncogenic activation of the WNT/beta-catenin signaling pathway is common in hepatocellular carcinoma.
15194563 Wnt regulation of the Lef-1 promoter at the WRE may play an important role during airway submucosal glandular bud formation.
15149841 CTNNB strongly increased activity of the eN/Nt5 promoter and this increase depended on the presence of TCF-1; demonstrated a link between Wnt signaling and the regulation of eN and ADA, which control the metabolism of adenosine
14960582 Wnt signal transduction through the Tak1 pathway phosphorylates and inhibits TCF, which might function as a feedback mechanism
14644163 Wnt signaling has a role in endothelial cell growth control and this is mediated through cell-cell contact
12209999 Role of Wnt pathway in medulloblastoma oncogenesis: accumulation of beta-catenin in tumor cells was immunohistochemically proven in 5 cases; 2 cases showed positive immunoreactivity for Wnt-1 and another 2 showed mutation of either CTNNB1 or AXIN1
12154096 Data show that Wnt-1 induces expression of antiapoptotic genes in 3T3-L1 preadipocytes such as IGF-I and IGF-II, which allows these cells to resist apoptosis in response to serum deprivation.
12014624 The potential role of the WNT-1 gene in basal cell carcinoma seems to correlate with its ability to induce elevated cytoplasmic beta-catenin levels.
11832495 Synergistic induction of tumor antigens by Wnt-1 signaling and retinoic acid revealed by gene expression profiling
11782388 Wnt-1 but not epidermal growth factor induces beta-catenin/T-cell factor-dependent transcription in esophageal cancer cells.

AA Sequence

MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRR      1 - 70
LIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVA     71 - 140
RSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTV    141 - 210
FSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPA    211 - 280
HKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFH    281 - 350
WCCHVSCRNCTHTRVLHECL                                                      351 - 370
//

Text Mined References (173)

PMID Year Title
26707142 2016 MicroRNA-148a inhibits breast cancer migration and invasion by directly targeting WNT-1.
26592459 2016 The Notch intracellular domain integrates signals from Wnt, Hedgehog, TGF?/BMP and hypoxia pathways.
26499380 2015 Overexpression of Klotho suppresses liver cancer progression and induces cell apoptosis by negatively regulating wnt/?-catenin signaling pathway.
26450645 2015 IWR-1 inhibits epithelial-mesenchymal transition of colorectal cancer cells through suppressing Wnt/?-catenin signaling as well as survivin expression.
26421711 2015 Mitochondrial mass, a new metabolic biomarker for stem-like cancer cells: Understanding WNT/FGF-driven anabolic signaling.
26261683 2015 Cross-talk between TGF-?/Smad pathway and Wnt/?-catenin pathway in pathological scar formation.
26214410 2015 Wnt1-induced MAFK expression promotes osteosarcoma cell proliferation.
26049140 2015 A WNT1-regulated developmental gene cascade prevents dopaminergic neurodegeneration in adult En1(+/-) mice.
25909283 2015 Fibulin-5 inhibits Wnt/?-catenin signaling in lung cancer.
25721714 2015 Wnt1 positively regulates CD36 expression via TCF4 and PPAR-? in macrophages.
25677507 Agonists of epoxyeicosatrienoic acids reduce infarct size and ameliorate cardiac dysfunction via activation of HO-1 and Wnt1 canonical pathway.
25627001 2015 MiR-148b suppresses cell proliferation and invasion in hepatocellular carcinoma by targeting WNT1/?-catenin pathway.
25618247 2015 Crucial roles of canonical Runx2-dependent pathway on Wnt1-induced osteoblastic differentiation of human periodontal ligament fibroblasts.
25422594 2014 Inactivation of RAR? inhibits Wnt1-induced mammary tumorigenesis by suppressing epithelial-mesenchymal transitions.
25350852 2014 Human breast progenitor cell numbers are regulated by WNT and TBX3.
25197350 2014 Sox9 regulates hyperexpression of Wnt1 and Fzd1 in human osteosarcoma tissues and cells.
25143352 2014 The river blindness drug Ivermectin and related macrocyclic lactones inhibit WNT-TCF pathway responses in human cancer.
25076852 2014 Wnt signaling as a possible promoting factor of cell differentiation in pleomorphic adenomas.
25010833 2014 Skeletal characteristics associated with homozygous and heterozygous WNT1 mutations.
24863942 2014 MiR-122/Wnt/?-catenin regulatory circuitry sustains glioma progression.
24713700 2014 Inhibition of cancer cell migration and invasion through suppressing the Wnt1-mediating signal pathway by G-quadruplex structure stabilizers.
24659666 WNT1 gene expression alters in heterogeneous population of prostate cancer cells; decreased expression pattern observed in CD133+/CD44+ prostate cancer stem cell spheroids.
24499657 2014 Wnt/?-catenin pathway as a potential prognostic and predictive marker in patients with advanced ovarian cancer.
24481453 2014 Roles of Wnt/?-catenin signaling in the gastric cancer stem cells proliferation and salinomycin treatment.
24480807 2014 Fibulin-3 suppresses Wnt/?-catenin signaling and lung cancer invasion.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24416131 2014 HCV core protein-induced down-regulation of microRNA-152 promoted aberrant proliferation by regulating Wnt1 in HepG2 cells.
24374807 2014 EMILIN2 down-modulates the Wnt signalling pathway and suppresses breast cancer cell growth and migration.
24305876 2014 FGFR1-WNT-TGF-? signaling in prostate cancer mouse models recapitulates human reactive stroma.
24301659 2014 Hypoxic macrophages impair autophagy in epithelial cells through Wnt1: relevance in IBD.
24067880 2014 Activated wnt signaling in stroma contributes to development of pancreatic mucinous cystic neoplasms.
24002087 2013 A rare WNT1 missense variant overrepresented in ASD leads to increased Wnt signal pathway activation.
23913826 2013 ERG is a critical regulator of Wnt/LEF1 signaling in prostate cancer.
23851184 2013 Diallyl disulfide suppresses proliferation and induces apoptosis in human gastric cancer through Wnt-1 signaling pathway by up-regulation of miR-200b and miR-22.
23708097 2013 Impact of an altered Wnt1/?-catenin expression on clinicopathology and prognosis in clear cell renal cell carcinoma.
23656646 2013 WNT1 mutations in early-onset osteoporosis and osteogenesis imperfecta.
23613467 2013 The Wnt-?-catenin pathway represses let-7 microRNA expression through transactivation of Lin28 to augment breast cancer stem cell expansion.
23605563 2013 Wnt signaling behaves as a "master regulator" in the osteogenic and adipogenic commitment of human amniotic fluid mesenchymal stem cells.
23551536 2013 An immunohistochemical evaluation of the proteins Wnt1 and glycogen synthase kinase (GSK)-3? in invasive breast carcinomas.
23499310 2013 WNT1 mutations in families affected by moderately severe and progressive recessive osteogenesis imperfecta.
23499309 2013 Mutations in WNT1 cause different forms of bone fragility.
23461676 2013 Uncovering novel actors in astrocyte-neuron crosstalk in Parkinson's disease: the Wnt/?-catenin signaling cascade as the common final pathway for neuroprotection and self-repair.
23434763 2013 Mutations in WNT1 are a cause of osteogenesis imperfecta.
23379509 2013 An emerging role for Wnt and GSK3 signaling pathways in schizophrenia.
23284750 2012 Epigenetic changes in Basal Cell Carcinoma affect SHH and WNT signaling components.
23152495 2013 Matrix rigidity activates Wnt signaling through down-regulation of Dickkopf-1 protein.
23134367 2013 Psychiatric disorder-related abnormal behavior and habenulointerpeduncular pathway defects in Wnt1-cre and Wnt1-GAL4 double transgenic mice.
22988876 2012 The importance of Wnt signalling for neurodegeneration in Parkinson's disease.
22954590 2012 Loss of Mel-18 enhances breast cancer stem cell activity and tumorigenicity through activating Notch signaling mediated by the Wnt/TCF pathway.
22859293 2012 Regulator of G-protein signaling 3 isoform 1 (PDZ-RGS3) enhances canonical Wnt signaling and promotes epithelial mesenchymal transition.
22823957 2012 Wnt/?-catenin pathway regulates ABCB1 transcription in chronic myeloid leukemia.
22815884 2012 R-Spondin potentiates Wnt/?-catenin signaling through orphan receptors LGR4 and LGR5.
22696217 2012 Characterization of the interaction of sclerostin with the low density lipoprotein receptor-related protein (LRP) family of Wnt co-receptors.
22546285 2013 Regulation of intestinal cancer stem cells.
22494971 2012 Ras stabilization through aberrant activation of Wnt/?-catenin signaling promotes intestinal tumorigenesis.
22406377 2012 Metformin-mediated Bambi expression in hepatic stellate cells induces prosurvival Wnt/?-catenin signaling.
22392999 2012 Wnt/?-catenin signaling promotes differentiation, not self-renewal, of human embryonic stem cells and is repressed by Oct4.
22391424 2012 Premature myocardial infarction is associated with low serum levels of Wnt-1.
22388478 2012 Prevention of ?-amyloid degeneration of microglia by erythropoietin depends on Wnt1, the PI 3-K/mTOR pathway, Bad, and Bcl-xL.
22351518 2012 Epigenetic silencing of sFRP1 activates the canonical Wnt pathway and contributes to increased cell growth and proliferation in hepatocellular carcinoma.
22270359 2012 Leptin-induced epithelial-mesenchymal transition in breast cancer cells requires ?-catenin activation via Akt/GSK3- and MTA1/Wnt1 protein-dependent pathways.
22139084 2012 The human cadherin 11 is a pro-apoptotic tumor suppressor modulating cell stemness through Wnt/?-catenin signaling and silenced in common carcinomas.
22123293 2012 Developmental pathways in breast cancer and breast tumor-initiating cells: therapeutic implications.
22117039 2012 The canonical Wnt pathway shapes niches supportive of hematopoietic stem/progenitor cells.
21971039 2011 Genome-wide analysis of a Wnt1-regulated transcriptional network implicates neurodegenerative pathways.
21858154 2011 Vitamin D receptor deficiency enhances Wnt/?-catenin signaling and tumor burden in colon cancer.
21851818 2011 Wnt/Myc interactions in intestinal cancer: partners in crime.
21781302 2011 Protein-bound polysaccharide from Phellinus linteus inhibits tumor growth, invasion, and angiogenesis and alters Wnt/?-catenin in SW480 human colon cancer cells.
21680704 2011 Inactivation of AR/TMPRSS2-ERG/Wnt signaling networks attenuates the aggressive behavior of prostate cancer cells.
21678109 2011 Prognostic significance of Wnt-1, ?-catenin and E-cadherin expression in advanced colorectal carcinoma.
21505183 2011 Inhibition of PDE5 by sulindac sulfide selectively induces apoptosis and attenuates oncogenic Wnt/?-catenin-mediated transcription in human breast tumor cells.
21344486 2011 Expression profile of WNT molecules in prostate cancer and its regulation by aminobisphosphonates.
21336184 2011 Aberrant Wnt1/?-catenin expression is an independent poor prognostic marker of non-small cell lung cancer after surgery.
21321190 2011 Wnt1 is a proangiogenic molecule, enhances human endothelial progenitor function, and increases blood flow to ischemic limbs in a HGF-dependent manner.
21317455 2010 The class I HDAC inhibitor MGCD0103 induces cell cycle arrest and apoptosis in colon cancer initiating cells by upregulating Dickkopf-1 and non-canonical Wnt signaling.
21259057 2012 Association of ?-catenin, Wnt1, Smad4, Hoxa9, and Bmi-1 with the prognosis of esophageal squamous cell carcinoma.
21244856 2011 Fatty acid modification of Wnt1 and Wnt3a at serine is prerequisite for lipidation at cysteine and is essential for Wnt signalling.
21044957 2010 Identification of transmembrane protein 88 (TMEM88) as a dishevelled-binding protein.
20865400 2011 Ras regulates interleukin-1?-induced HIF-1? transcriptional activity in glioblastoma.
20809334 2011 Wnt/beta-Catenin pathway in human glioma: expression pattern and clinical/prognostic correlations.
20664938 2010 Intratumoral Wnt1 expression affects survivin gene expression in non-small cell lung cancer.
20564229 2010 Epithelial stem cells: an epigenetic and Wnt-centric perspective.
20491588 2010 Association of Wnt1/beta-catenin with clinical pathological characteristics and prognosis of esophageal squamous cell carcinoma.
20334650 2010 Expression and aberrant promoter methylation of Wnt inhibitory factor-1 in human astrocytomas.
19956832 2010 Active Wnt signalling is associated with low differentiation and high proliferation in human biliary tract cancer in vitro and in vivo and is sensitive to pharmacological inhibition.
19956716 2009 Mutations in the human naked cuticle homolog NKD1 found in colorectal cancer alter Wnt/Dvl/beta-catenin signaling.
19924227 2009 Integration of the beta-catenin-dependent Wnt pathway with integrin signaling through the adaptor molecule Grb2.
19885602 2009 Procaine and procainamide inhibit the Wnt canonical pathway by promoter demethylation of WIF-1 in lung cancer cells.
19847889 2010 SUZ12 is a candidate target of the non-canonical WNT pathway in the progression of chronic myeloid leukemia.
19781444 2009 Overexpression of the novel oncogene SALL4 and activation of the Wnt/beta-catenin pathway in myelodysplastic syndromes.
19778454 2009 Blockade of Wnt-1 signaling leads to anti-tumor effects in hepatocellular carcinoma cells.
19756656 2009 The effect on cell growth by Wnt1 RNAi in human neuroblastoma SH-SY5Y cell line.
19734317 2009 Mesenchymal stem cells produce Wnt isoforms and TGF-beta1 that mediate proliferation and procollagen expression by lung fibroblasts.
19729480 2009 HMGA1 is induced by Wnt/beta-catenin pathway and maintains cell proliferation in gastric cancer.
19711366 2009 Phosphorylation of PPP(S/T)P motif of the free LRP6 intracellular domain is not required to activate the Wnt/beta-catenin pathway and attenuate GSK3beta activity.
19693690 2010 Characterization of a novel human CDK5 splicing variant that inhibits Wnt/beta-catenin signaling.
19628668 2009 Wnt/beta-catenin signaling promotes podocyte dysfunction and albuminuria.
19473496 2009 WNT signaling enhances breast cancer cell motility and blockade of the WNT pathway by sFRP1 suppresses MDA-MB-231 xenograft growth.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19448422 2009 Expression and clinical significance of Wnt-1 and beta-catenin in nasopharyngeal carcinoma.
19401692 2009 Activation of Wnt/beta-catenin signalling pathway induces chemoresistance to interferon-alpha/5-fluorouracil combination therapy for hepatocellular carcinoma.
19398721 2009 MicroRNA profiling identifies miR-34a and miR-21 and their target genes JAG1 and WNT1 in the coordinate regulation of dendritic cell differentiation.
19349579 2009 Canonical Wnts function as potent regulators of osteogenesis by human mesenchymal stem cells.
19148501 2009 Canonical and noncanonical Wnt pathway: a comparison among normal ovary, benign ovarian tumor and ovarian cancer.
19061838 2008 Hepatic stem-like phenotype and interplay of Wnt/beta-catenin and Myc signaling in aggressive childhood liver cancer.
18936100 2008 Dapper1 is a nucleocytoplasmic shuttling protein that negatively modulates Wnt signaling in the nucleus.
18844223 2009 Somatic mutations of adenomatous polyposis coli gene and nuclear b-catenin accumulation have prognostic significance in invasive urothelial carcinomas: evidence for Wnt pathway implication.
18838960 2008 Overexpression of fatty acid synthase is associated with palmitoylation of Wnt1 and cytoplasmic stabilization of beta-catenin in prostate cancer.
18824543 2008 Tumor hypoxia blocks Wnt processing and secretion through the induction of endoplasmic reticulum stress.
18790633 2008 Wnt1 overexpression promotes tumour progression in non-small cell lung cancer.
18769117 2008 HDAC3 impacts multiple oncogenic pathways in colon cancer cells with effects on Wnt and vitamin D signaling.
18769115 2008 Knockdown of RCK/p54 expression by RNAi inhibits proliferation of human colorectal cancer cells in vitro and in vivo.
18705344 Wnt pathway is involved in advanced gastric carcinoma.
18676739 2008 OPG is regulated by beta-catenin and mediates resistance to TRAIL-induced apoptosis in colon cancer.
18593917 2008 Hypoxia-inducible factor-1alpha obstructs a Wnt signaling pathway by inhibiting the hARD1-mediated activation of beta-catenin.
18469861 2008 Snail promotes Wnt target gene expression and interacts with beta-catenin.
18461473 2008 Anti-sense morpholino oligonucleotide assay shows critical involvement for NF-kappaB activation in the production of Wnt-1 protein by HepG2 cells: oncology implications.
18297060 2008 MesP1 drives vertebrate cardiovascular differentiation through Dkk-1-mediated blockade of Wnt-signalling.
18218837 2008 Wnt/beta-catenin inhibits dental pulp stem cell differentiation.
18097596 2008 Wnt1 overexpression associated with tumor proliferation and a poor prognosis in non-small cell lung cancer patients.
18059186 2008 Silencing of Wnt-1 by siRNA induces apoptosis of MCF-7 human breast cancer cells.
18056036 2007 Vascular Bmp Msx2 Wnt signaling and oxidative stress in arterial calcification.
17982423 2007 Stem cell markers in the human posterior limbus and corneal endothelium of unwounded and wounded corneas.
17947472 2007 Synchronous alterations of Wnt and epidermal growth factor receptor signaling pathways through aberrant methylation and mutation in non small cell lung cancer.
17875805 2008 Wnt signaling promotes hematoendothelial cell development from human embryonic stem cells.
17306035 2007 Wnt signaling induces differentiation of progenitor cells in organotypic keratinocyte cultures.
17289346 2007 Cellular demise and inflammatory microglial activation during beta-amyloid toxicity are governed by Wnt1 and canonical signaling pathways.
17143299 2006 The ups and downs of Wnt signaling in prevalent neurological disorders.
17072303 2006 A Wnt-Axin2-GSK3beta cascade regulates Snail1 activity in breast cancer cells.
17035233 2006 Suppressing Wnt signaling by the hedgehog pathway through sFRP-1.
16930536 2006 The Wnt signaling pathway has tumor suppressor properties in retinoblastoma.
16760136 Absolute beta-catenin concentrations in Wnt pathway-stimulated and non-stimulated cells.
16756720 2006 Aberrant Wnt/beta-catenin signaling in pancreatic adenocarcinoma.
16565090 2006 Mediator is a transducer of Wnt/beta-catenin signaling.
16501043 2006 Increased Wnt signaling triggers oncogenic conversion of human breast epithelial cells by a Notch-dependent mechanism.
16495219 2006 Suppression of Wnt signaling by the green tea compound (-)-epigallocatechin 3-gallate (EGCG) in invasive breast cancer cells. Requirement of the transcriptional repressor HBP1.
16474850 2006 Complex regulation of human androgen receptor expression by Wnt signaling in prostate cancer cells.
16427602 2006 Wnt signaling activation and WIF-1 silencing in nasopharyngeal cancer cell lines.
16329837 2005 [Roles of Wnt-1, beta-catenin and adenomatous polyposis coli in the differentiation and proliferation of oral squamous cell carcinoma].
16194878 BMP-2-modulated chondrogenic differentiation in vitro involves down-regulation of membrane-bound beta-catenin.
15913453 2005 Efficacy of Wnt-1 monoclonal antibody in sarcoma cells.
15841445 2005 Hepatitis C virus core protein stimulates hepatocyte growth: correlation with upregulation of wnt-1 expression.
15824740 2005 Estrogen receptor positivity in mammary tumors of Wnt-1 transgenic mice is influenced by collaborating oncogenic mutations.
15592430 2005 FGF-20 and DKK1 are transcriptional targets of beta-catenin and FGF-20 is implicated in cancer and development.
15580286 2005 HDPR1, a novel inhibitor of the WNT/beta-catenin signaling, is frequently downregulated in hepatocellular carcinoma: involvement of methylation-mediated gene silencing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454084 2004 Mammalian Ryk is a Wnt coreceptor required for stimulation of neurite outgrowth.
15194563 2004 Wnt-responsive element controls Lef-1 promoter expression during submucosal gland morphogenesis.
15149841 2004 Wnt and beta-catenin signaling target the expression of ecto-5'-nucleotidase and increase extracellular adenosine generation.
14960582 2004 Wnt activates the Tak1/Nemo-like kinase pathway.
14644163 2003 Wnt-1 signaling inhibits human umbilical vein endothelial cell proliferation and alters cell morphology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12209999 2002 Role of Wnt pathway in medulloblastoma oncogenesis.
12154096 2002 Wnt signaling protects 3T3-L1 preadipocytes from apoptosis through induction of insulin-like growth factors.
12014624 WNT-1 expression in basal cell carcinoma of head and neck. An immunohistochemical and confocal study with regard to the intracellular distribution of beta-catenin.
11832495 2002 Synergistic induction of tumor antigens by Wnt-1 signaling and retinoic acid revealed by gene expression profiling.
11793365 2002 Expression of frizzled-related protein and Wnt-signalling molecules in invasive human breast tumours.
11448771 2001 Head inducer Dickkopf-1 is a ligand for Wnt coreceptor LRP6.
11350055 2001 WNT10A and WNT6, clustered in human chromosome 2q35 region with head-to-tail manner, are strongly coexpressed in SW480 cells.
11336703 2001 Low-density lipoprotein receptor-related protein-5 binds to Axin and regulates the canonical Wnt signaling pathway.
11029007 2000 LDL-receptor-related proteins in Wnt signal transduction.
10866835 2000 The evolutionarily conserved porcupine gene family is involved in the processing of the Wnt family.
10654605 2000 SHH-N upregulates Sfrp2 to mediate its competitive interaction with WNT1 and WNT4 in the somitic mesoderm.
10644691 2000 Protein phosphatase 2Calpha dephosphorylates axin and activates LEF-1-dependent transcription.
10557084 1999 Human frizzled 1 interacts with transforming Wnts to transduce a TCF dependent transcriptional response.
10511339 1999 Clinical nosologic and genetic aspects of Joubert and related syndromes.
10347172 1999 Interaction of frizzled related protein (FRP) with Wnt ligands and the frizzled receptor suggests alternative mechanisms for FRP inhibition of Wnt signaling.
9147651 1997 A novel human homologue of the Drosophila frizzled wnt receptor gene binds wingless protein and is in the Williams syndrome deletion at 7q11.23.
3329717 The human int-1 gene is located at chromosome region 12q12-12q13 and is not rearranged in myxoid liposarcoma with t(12;16) (q13;p11).
3281802 1988 Chromosome localization of the human oncogene INT1 to 12q13 by in situ hybridization.
2998762 1985 The nucleotide sequence of the human int-1 mammary oncogene; evolutionary conservation of coding and non-coding sequences.
2534596 1989 int-1--a proto-oncogene involved in cell signalling.
2202907 1990 Targeted disruption of the murine int-1 proto-oncogene resulting in severe abnormalities in midbrain and cerebellar development.