Property Summary

NCBI Gene PubMed Count 24
PubMed Score 8.93
PubTator Score 20.04

Knowledge Summary

Patent (1,107)

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma -1.900 2.8e-10
oligodendroglioma -1.100 8.2e-15
osteosarcoma -1.512 9.4e-07
ependymoma -1.300 5.2e-07
atypical teratoid/rhabdoid tumor -1.900 6.9e-11
primitive neuroectodermal tumor -1.100 2.8e-03
adult high grade glioma -2.200 1.0e-07
pilocytic astrocytoma -2.200 3.3e-13
sonic hedgehog group medulloblastoma -1.100 1.2e-03
subependymal giant cell astrocytoma -1.285 4.5e-02
lung carcinoma 1.600 1.4e-35
spina bifida 1.051 4.0e-02
psoriasis -2.400 2.0e-94

Gene RIF (13)

PMID Text
25596741 WNK2 promoter methylation and silencing in gliomas is associated with increased JNK activation and MMP2 expression and activity, thus explaining in part tumor cell invasion potential.
23912455 Downregulation of WNK2 by promoter hypermethylation occurs early in Pancreatic ductal adenocarcinoma pathogenesis and may support tumor cell growth via the ERK-MAPK pathway.
23797875 Wnk kinases are positive regulators of canonical Wnt/beta-catenin signaling.
23035050 results validate the WNK2 gene as a recurrent target for epigenetic silencing in glia-derived brain tumours and provide first mechanistic evidence for a tumour-suppressing role of WNK2 that is related to Rac1 signalling and tumour cell invasion and growth
21733846 a role for WNK2 in the regulation of CCCs in the mammalian brain, with implications for both cell volume regulation and/or GABAergic signaling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)
19001526 Epigenetic silencing of the kinase tumor suppressor WNK2 is tumor-type and tumor-grade specific.
18593598 WNK2 controls a RhoA-mediated cross-talk mechanism that regulates the efficiency with which MEK1 can activate ERK1/2 upon growth factor stimulation.
17667937 WNK2 is involved in the modulation of growth factor-induced cancer cell proliferation through the MEK1/ERK1/2 pathway.
17578925 epigenetic silencing, occasional deletion and point mutation, and functional assessment suggest that aberrations of WNK2 may contribute to unregulated tumor cell growth

AA Sequence

MDGDGGRRDVPGTLMEPGRGAGPAGMAEPRAKAARPGPQRFLRRSVVESDQEEPPGLEAAEAPGPQPPQP      1 - 70
LQRRVLLLCKTRRLIAERARGRPAAPAPAALVAQPGAPGAPADAGPEPVGTQEPGPDPIAAAVETAPAPD     71 - 140
GGPREEAAATVRKEDEGAAEAKPEPGRTRRDEPEEEEDDEDDLKAVATSLDGRFLKFDIELGRGSFKTVY    141 - 210
KGLDTETWVEVAWCELQDRKLTKLERQRFKEEAEMLKGLQHPNIVRFYDFWESSAKGKRCIVLVTELMTS    211 - 280
GTLKTYLKRFKVMKPKVLRSWCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKR    281 - 350
ASFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEK    351 - 420
VHDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRLWVEDPKKLKGKP    421 - 490
KDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQWRRERIWPALQPKEQQDVGS    491 - 560
PDKARGPPVPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQS    561 - 630
SQQSVMLGSLADAAPSPAQCVCSPPVSEGPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFP    631 - 700
DPAMSFAPVLPPPSTPMPTGPGQPAPPGQQPPPLAQPTPLPQVLAPQPVVPLQPVPPHLPPYLAPASQVG    701 - 770
APAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGIDGLPPALPDLPTATVPPVPPPQYFSPAVIL    771 - 840
PSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIHSAVAQLPGQP    841 - 910
VYPAAFPQMAPTDVPPSPHHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVL    911 - 980
PPQPMLPPQPVLPPQPALPVRPEPLQPHLPEQAAPAATPGSQILLGHPAPYAVDVAAQVPTVPVPPAAVL    981 - 1050
SPPLPEVLLPAAPELLPQFPSSLATVSASVQSVPTQTATLLPPANPPLPGGPGIASPCPTVQLTVEPVQE   1051 - 1120
EQASQDKPPGLPQSCESYGGSDVTSGKELSDSCEGAFGGGRLEGRAARKHHRRSTRARSRQERASRPRLT   1121 - 1190
ILNVCNTGDKMVECQLETHNHKMVTFKFDLDGDAPDEIATYMVEHDFILQAERETFIEQMKDVMDKAEDM   1191 - 1260
LSEDTDADRGSDPGTSPPHLSTCGLGTGEESRQSQANAPVYQQNVLHTGKRWFIICPVAEHPAPEAPESS   1261 - 1330
PPLPLSSLPPEASQGPCRGLTLPCLPWRRAACGAVFLSLFSAESAQSKQPPDSAPYKDQLSSKEQPSFLA   1331 - 1400
SQQLLSQAGPSNPPGAPPAPLAPSSPPVTALPQDGAAPATSTMPEPASGTASQAGGPGTPQGLTSELETS   1401 - 1470
QPLAETHEAPLAVQPLVVGLAPCTPAPEAASTRDASAPREPLPPPAPEPSPHSGTPQPALGQPAPLLPAA   1471 - 1540
VGAVSLATSQLPSPPLGPTVPPQPPSALESDGEGPPPRVGFVDSTIKSLDEKLRTLLYQEHVPTSSASAG   1541 - 1610
TPVEVGDRDFTLEPLRGDQPRSEVCGGDLALPPVPKEAVSGRVQLPQPLVEKSELAPTRGAVMEQGTSSS   1611 - 1680
MTAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFVRPARVEPTDRDGGEAGESSAEPPPSDMGTVGG   1681 - 1750
QASHPQTLGARALGSPRKRPEQQDVSSPAKTVGRFSVVSTQDEWTLASPHSLRYSAPPDVYLDEAPSSPD   1751 - 1820
VKLAVRRAQTASSIEVGVGEPVSSDSGDEGPRARPPVQKQASLPVSGSVAGDFVKKATAFLQRPSRAGSL   1821 - 1890
GPETPSRVGMKVPTISVTSFHSQSSYISSDNDSELEDADIKKELQSLREKHLKEISELQSQQKQEIEALY   1891 - 1960
RRLGKPLPPNVGFFHTAPPTGRRRKTSKSKLKAGKLLNPLVRQLKVVASSTGHLADSSRGPPAKDPAQAS   1961 - 2030
VGLTADSTGLSGKAVQTQQPCSVRASLSSDICSGLASDGGGARGQGWTVYHPTSERVTYKSSSKPRARFL   2031 - 2100
SGPVSVSIWSALKRLCLGKEHSSRSSTSSLAPGPEPGPQPALHVQAQVNNSNNKKGTFTDDLHKLVDEWT   2101 - 2170
SKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMPRLPPAPGPLSTTVIPGAAPT   2171 - 2240
LSVPTPDGALGTARRNQVWFGLRVPPTACCGHSTQPRGGQRVGSKTASFAASDPVRS                2241 - 2297
//

Text Mined References (28)

PMID Year Title
25596741 2015 Silencing of the tumor suppressor gene WNK2 is associated with upregulation of MMP2 and JNK in gliomas.
23912455 2014 Early epigenetic downregulation of WNK2 kinase during pancreatic ductal adenocarcinoma development.
23797875 2013 Wnk kinases are positive regulators of canonical Wnt/?-catenin signalling.
23035050 2013 Loss of WNK2 expression by promoter gene methylation occurs in adult gliomas and triggers Rac1-mediated tumour cell invasiveness.
21733846 2011 WNK2 kinase is a novel regulator of essential neuronal cation-chloride cotransporters.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19001526 2009 Epigenetic silencing of the kinase tumor suppressor WNK2 is tumor-type and tumor-grade specific.
18768590 2008 WNK3 positively regulates epithelial calcium channels TRPV5 and TRPV6 via a kinase-dependent pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18593598 2008 WNK2 modulates MEK1 activity through the Rho GTPase pathway.
17667937 2007 Protein kinase WNK2 inhibits cell proliferation by negatively modulating the activation of MEK1/ERK1/2.
17578925 2007 Epigenome scans and cancer genome sequencing converge on WNK2, a kinase-independent suppressor of cell growth.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11571656 2001 WNK kinases, a novel protein kinase subfamily in multi-cellular organisms.
11498583 2001 Human hypertension caused by mutations in WNK kinases.
11280764 2001 Molecular basis of T cell-mediated recognition of pancreatic cancer cells.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9610721 1998 Characterization of human colon cancer antigens recognized by autologous antibodies.